Recombinant Rabies virus G Protein, His-SUMO-tagged
| Cat.No. : | G-1219R |
| Product Overview : | Recombinant Rabies virus (strain PM) (RABV) G Protein (20-459aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabies virus |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 20-459 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 65.4 kDa |
| AA Sequence : | KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMATKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPSWGKY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Glycoprotein |
| Official Symbol | Glycoprotein |
| Synonyms | Glycoprotein; G |
| UniProt ID | A3RM22 |
| ◆ Recombinant Proteins | ||
| Glycoprotein-42R | Recombinant Rabies Virus Glycoprotein, C-6×His tagged | +Inquiry |
| Glycoprotein-5661R | Recombinant Rabies lyssavirus Glyco Protein (Lys20-Glu458), N-GST and C-His tagged | +Inquiry |
| Glycoprotein-772V | Recombinant Varicella-zoster Virus GlycoProtein E Protein | +Inquiry |
| G-1219R | Recombinant Rabies virus G Protein, His-SUMO-tagged | +Inquiry |
| glycoprotein-647R | Recombinant Rotavirus Non-structural glycoprotein 4, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Glycoprotein Products
Required fields are marked with *
My Review for All Glycoprotein Products
Required fields are marked with *
Recently Viewed
