Recombinant Rabies virus G Protein, His-SUMO-tagged

Cat.No. : G-1219R
Product Overview : Recombinant Rabies virus (strain PM) (RABV) G Protein (20-459aa) was expressed in E. coli with N-terminal His-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rabies virus
Source : E.coli
Tag : His&SUMO
Protein Length : 20-459 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 65.4 kDa
AA Sequence : KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMATKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPSWGKY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Glycoprotein
Official Symbol Glycoprotein
Synonyms Glycoprotein; G
UniProt ID A3RM22

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Glycoprotein Products

Required fields are marked with *

My Review for All Glycoprotein Products

Required fields are marked with *

0
cart-icon