Recombinant Rotavirus Non-structural glycoprotein 4, His-tagged
| Cat.No. : | glycoprotein-647R |
| Product Overview : | Recombinant Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) Non-structural glycoprotein 4(A9Q1L1)(73-213aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rotavirus X |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 73-213a.a. |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.2 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | QTSKIIYIVRLLFWKMYNVINNLVNKMINREKIADRQIVDNRFREFEERFRILLLQHDENIAKQDNIVQYNKLDNFAESIKSEFNLKVAEMERRFQELKWRCDMIANKTMNTIVLTNTVDSTNKDEKIIFDEGSVVQYNRE |
| ◆ Recombinant Proteins | ||
| G-1219R | Recombinant Rabies virus G Protein, His-SUMO-tagged | +Inquiry |
| Glycoprotein-772V | Recombinant Varicella-zoster Virus GlycoProtein E Protein | +Inquiry |
| Glycoprotein-42R | Recombinant Rabies Virus Glycoprotein, C-6×His tagged | +Inquiry |
| Glycoprotein-5661R | Recombinant Rabies lyssavirus Glyco Protein (Lys20-Glu458), N-GST and C-His tagged | +Inquiry |
| glycoprotein-647R | Recombinant Rotavirus Non-structural glycoprotein 4, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All glycoprotein Products
Required fields are marked with *
My Review for All glycoprotein Products
Required fields are marked with *
