Recombinant Rabies Virus Glycoprotein, C-6×His tagged

Cat.No. : Glycoprotein-42R
Product Overview : C-terminal 6×His tagged glycoprotein (amino acid 20-458) of Rabies virus (GenBank Accession No. BAI50726)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rabies Virus
Source : E.coli
Tag : His
Description : Rabies lyssavirus (genus of the Rhabdoviridae family), formerly Rabies virus, is a neurotropic virus that causes rabies in humans and animals. Rabies virus is a rod- or bullet-shaped, single-stranded, negative-sense, unsegmented, enveloped RNA virus. The rabies genome encodes five proteins: nucleoprotein (N), phosphoprotein (P), matrix protein (M), glycoprotein (G) and polymerase (L). It has two major structural components: a helical ribonucleoprotein core (RNP) and a surrounding lipoprotein envelope embedded with knob-like Glycoprotein (G) spikes.
AA Sequence : KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPMPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPGGKCSGITVSSTCCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAIQTSDEIKWCSPDQLVNLHDFHSDEIEHLVVEELVKKREECLDALETIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSIRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLHQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPNWGKHHHHHH
Purity : ≥ 90%
Applications : Western blot standard, antibody ELISA, antigen, etc.
Storage : This product will expire after one year when kept at -20 centigrade; Stable for 1-months from the date of shipment when kept at 4 centigrade. Non-hazardous. No MSDS required.
Concentration : 1 μg/μL in PBS with 8M Urea
Official Symbol Glycoprotein

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Glycoprotein Products

Required fields are marked with *

My Review for All Glycoprotein Products

Required fields are marked with *

0
cart-icon