| Species : |
Rabies Virus |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
Rabies lyssavirus (genus of the Rhabdoviridae family), formerly Rabies virus, is a neurotropic virus that causes rabies in humans and animals. Rabies virus is a rod- or bullet-shaped, single-stranded, negative-sense, unsegmented, enveloped RNA virus. The rabies genome encodes five proteins: nucleoprotein (N), phosphoprotein (P), matrix protein (M), glycoprotein (G) and polymerase (L). It has two major structural components: a helical ribonucleoprotein core (RNP) and a surrounding lipoprotein envelope embedded with knob-like Glycoprotein (G) spikes. |
| AA Sequence : |
KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPMPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPGGKCSGITVSSTCCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAIQTSDEIKWCSPDQLVNLHDFHSDEIEHLVVEELVKKREECLDALETIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSIRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLHQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPNWGKHHHHHH |
| Purity : |
≥ 90% |
| Applications : |
Western blot standard, antibody ELISA, antigen, etc. |
| Storage : |
This product will expire after one year when kept at -20 centigrade; Stable for 1-months from the date of shipment when kept at 4 centigrade. Non-hazardous. No MSDS required. |
| Concentration : |
1 μg/μL in PBS with 8M Urea |