Recombinant Raphanus sativus Protein, His-SUMO-tagged
| Cat.No. : | AFP2-1110R |
| Product Overview : | Recombinant Raphanus sativus Protein (30-80aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Raphanus sativus |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 30-80 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 21.7 kDa |
| AA Sequence : | QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | defensin-like protein 2 [ Raphanus sativus (radish) ] |
| Official Symbol | AFP2 |
| Synonyms | AFP2; defensin-like protein 2; Rs-AFP2; antifungal protein 2 preprotein |
| Gene ID | 108832239 |
| UniProt ID | P30230 |
| ◆ Recombinant Proteins | ||
| AFP2-1110R | Recombinant Raphanus sativus Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AFP2 Products
Required fields are marked with *
My Review for All AFP2 Products
Required fields are marked with *
Recently Viewed
