Recombinant Rat Angpt2 protein(19-496aa), His-tagged
Cat.No. : | Angpt2-5135R |
Product Overview : | Recombinant Rat Angpt2 protein(O35462)(19-496aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-496aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 58.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | YNNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHSVQLQSMKEQKDQLQVLVSKQSSVIDELEKKLVTATVNNSVLQKQQHDLMETVNSLLTMMSSPDYKSSVAVPKEEKTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEVKAYCDMDMGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTSGHRYVLKIQLKDWEGSEAHSLYEHFYLSGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLTGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF |
Gene Name | Angpt2 angiopoietin 2 [ Rattus norvegicus ] |
Official Symbol | Angpt2 |
Synonyms | ANGPT2; angiopoietin 2; angiopoietin-2; Agpt2; Ang-2; |
Gene ID | 89805 |
mRNA Refseq | NM_134454 |
Protein Refseq | NP_604449 |
◆ Recombinant Proteins | ||
ANGPT2-415H | Active Recombinant Human ANGPT2 Protein (Met1-Phe496), His-tagged | +Inquiry |
ANGPT2-158H | Active Recombinant Human ANGPT2 Protein, His-tagged, Biotinylated | +Inquiry |
ANGPT2-55H | Recombinant Human ANGPT2 | +Inquiry |
Angpt2-88M | Recombinant Mouse Angpt2, FLAG-tagged | +Inquiry |
Angpt2-476M | Active Recombinant Mouse Angpt2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPT2-2228HCL | Recombinant Human ANGPT2 cell lysate | +Inquiry |
ANGPT2-001MCL | Recombinant Mouse ANGPT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Angpt2 Products
Required fields are marked with *
My Review for All Angpt2 Products
Required fields are marked with *
0
Inquiry Basket