Recombinant Rat Apoa5 protein, GST-tagged
Cat.No. : | Apoa5-2533R |
Product Overview : | Recombinant Rat Apoa5 protein(Q9QUH3)(21-367aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | GST |
Protein Length : | 21-367aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 66.4 kDa |
AA Sequence : | RKSFWEYFGQNSQGKGMMGQQQKLAQESLKGSLEQDLYNMNNFLEKLGPLREPGKEPPRLAQDPEGIRKQLQQELEEVSTRLEPYMAAKHQQVGWNLEGLRQQLKPYTVELMEQVGLSVQDLQEQLRMVGKGTKAQLLGGVDEAMSLLQDMQSRVLHHTDRVKELFHPYAERLVTGIGHHVQELHRSVAPHAVASPARLSRCVQTLSHKLTRKAKDLHTSIQRNLDQLRDELSTFIRVSTDGADNRDSLDPQALSDEVRQRLQAFRHDTYLQIAAFTQAIDQETEEIQHQLAPPPPSHSAFAPELGHSDSNKALSRLQSRLDDLWEDIAYGLHDQGHSQNNPEGHSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Apoa5 apolipoprotein A-V [ Rattus norvegicus ] |
Official Symbol | Apoa5 |
Synonyms | APOA5; apolipoprotein A-V; apo-AV; apoA-V; apolipoprotein A5; regeneration-associated protein 3; MGC108612; |
Gene ID | 140638 |
mRNA Refseq | NM_080576 |
Protein Refseq | NP_542143 |
◆ Recombinant Proteins | ||
APOA5-210C | Recombinant Cattle APOA5 Protein, His-tagged | +Inquiry |
APOA5-2484H | Recombinant Human APOA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Apoa5-213M | Recombinant Mouse Apoa5 Protein, His-tagged | +Inquiry |
APOA5-211C | Recombinant Chicken APOA5 Protein, His-tagged | +Inquiry |
APOA5-693H | Recombinant Human APOA5 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA5-8787HCL | Recombinant Human APOA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Apoa5 Products
Required fields are marked with *
My Review for All Apoa5 Products
Required fields are marked with *
0
Inquiry Basket