Recombinant Rat APOC3 Protein (21-101 aa), His-tagged
| Cat.No. : | APOC3-1333R |
| Product Overview : | Recombinant Rat APOC3 Protein (21-101 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 21-101 aa |
| Description : | Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assbly and secretion; Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 11.0 kDa |
| AA Sequence : | DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | Apoc3 apolipoprotein C-III [ Rattus norvegicus ] |
| Official Symbol | APOC3 |
| Synonyms | APOC3; apolipoprotein C-3; ApoC-III; apo-CIII; |
| Gene ID | 24207 |
| mRNA Refseq | NM_012501 |
| Protein Refseq | NP_036633 |
| UniProt ID | P06759 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC3 Products
Required fields are marked with *
My Review for All APOC3 Products
Required fields are marked with *



