Recombinant Rat APOC3 Protein (21-101 aa), His-tagged
Cat.No. : | APOC3-1333R |
Product Overview : | Recombinant Rat APOC3 Protein (21-101 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 21-101 aa |
Description : | Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assbly and secretion; Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 11.0 kDa |
AA Sequence : | DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | Apoc3 apolipoprotein C-III [ Rattus norvegicus ] |
Official Symbol | APOC3 |
Synonyms | APOC3; apolipoprotein C-3; ApoC-III; apo-CIII; |
Gene ID | 24207 |
mRNA Refseq | NM_012501 |
Protein Refseq | NP_036633 |
UniProt ID | P06759 |
◆ Recombinant Proteins | ||
APOC3-635M | Recombinant Mouse APOC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOC3-0638H | Recombinant Human APOC3 Protein, Tag Free | +Inquiry |
APOC3-1333R | Recombinant Rat APOC3 Protein (21-101 aa), His-tagged | +Inquiry |
APOC3-393H | Recombinant Human APOC3 protein, His/GST-tagged | +Inquiry |
APOC3-2539H | Recombinant Human APOC3 protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
APOC3-669H | Native Human APOC3 protein | +Inquiry |
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
APOC3-361H | Native Human Apolipoprotein C-III | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC3-8782HCL | Recombinant Human APOC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOC3 Products
Required fields are marked with *
My Review for All APOC3 Products
Required fields are marked with *
0
Inquiry Basket