Recombinant Rat Asgr1 protein, His&Myc-tagged
Cat.No. : | Asgr1-928R |
Product Overview : | Recombinant Rat Asgr1 protein(P02706)(61-284aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 61-284aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.9 kDa |
AA Sequence : | QNSQLREDLRVLRQNFSNFTVSTEDQVKALTTQGERVGRKMKLVESQLEKHQEDLREDHSRLLLHVKQLVSDVRSLSCQMAALRGNGSERICCPINWVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPLNTWIGLTDQNGPWKWVDGTDYETGFKNWRPGQPDDWYGHGLGGGEDCAHFTTDGHWNDDVCRRPYRWVCETELGKAN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Asgr1 asialoglycoprotein receptor 1 [ Rattus norvegicus ] |
Official Symbol | Asgr1 |
Synonyms | ASGR1; asialoglycoprotein receptor 1; HL-1; RHL-1; ASGPR 1; ASGP-R 1; hepatic lectin 1 RHL1; hepatic lectin 1, RHL1; asialoglycoprotein receptor (RHL1); Asialoglycoprotein receptor 1 (hepatic lectin); ASGR; RHL1; RATRHL1; |
Gene ID | 24210 |
mRNA Refseq | NM_012503 |
Protein Refseq | NP_036635 |
◆ Recombinant Proteins | ||
ASGR1-2816H | Recombinant Human ASGR1 Protein, MYC/DDK-tagged | +Inquiry |
Asgr1-656M | Recombinant Mouse Asgr1 Protein, MYC/DDK-tagged | +Inquiry |
RFL-8089MF | Recombinant Full Length Mouse Asialoglycoprotein Receptor 1(Asgr1) Protein, His-Tagged | +Inquiry |
ASGR1-2580H | Recombinant Human ASGR1 protein(71-150 aa), C-hFc & C-His-tagged | +Inquiry |
ASGR1-476R | Recombinant Rat ASGR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASGR1-3084MCL | Recombinant Mouse ASGR1 cell lysate | +Inquiry |
ASGR1-1601HCL | Recombinant Human ASGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Asgr1 Products
Required fields are marked with *
My Review for All Asgr1 Products
Required fields are marked with *
0
Inquiry Basket