Recombinant Rat Asgr1 protein, His&Myc-tagged

Cat.No. : Asgr1-929R
Product Overview : Recombinant Rat Asgr1 protein(P02706)(61-284aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in Mammalian cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Mammalian Cells
Tag : His&Myc
Protein Length : 61-284aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31 kDa
AA Sequence : QNSQLREDLRVLRQNFSNFTVSTEDQVKALTTQGERVGRKMKLVESQLEKHQEDLREDHSRLLLHVKQLVSDVRSLSCQMAALRGNGSERICCPINWVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPLNTWIGLTDQNGPWKWVDGTDYETGFKNWRPGQPDDWYGHGLGGGEDCAHFTTDGHWNDDVCRRPYRWVCETELGKAN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name Asgr1 asialoglycoprotein receptor 1 [ Rattus norvegicus ]
Official Symbol Asgr1
Synonyms ASGR1; asialoglycoprotein receptor 1; HL-1; RHL-1; ASGPR 1; ASGP-R 1; hepatic lectin 1 RHL1; hepatic lectin 1, RHL1; asialoglycoprotein receptor (RHL1); Asialoglycoprotein receptor 1 (hepatic lectin); ASGR; RHL1; RATRHL1;
Gene ID 24210
mRNA Refseq NM_012503
Protein Refseq NP_036635

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Asgr1 Products

Required fields are marked with *

My Review for All Asgr1 Products

Required fields are marked with *

0
cart-icon