Recombinant Rat Asgr2 Full Length Transmembrane protein, His-tagged
Cat.No. : | Asgr2-562R |
Product Overview : | Recombinant Rat Asgr2 protein(P08290)(1-301aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-301aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.1 kDa |
AA Sequence : | MEKDFQDIQQLDSEENDHQLIGDEEQGSHVQNLRTENPRWGGQPPSRPFPQRLCSKFRLSLLALAFNILLLVVICVVSSQSMQLQKEFWTLKETLSNFSTTTLMEFKALDSHGGSRNDNLTSWETILEKKQKDIKADHSTLLFHLKHFPLDLRTLTCQLAFFLSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQMENAHLLVINSREEQEFVVKHRGAFHIWIGLTDKDGSWKWVDGTEYRSNFKNWAFTQPDNWQGHEEGGSEDCAEILSDGLWNDNFCQQVNRWACERKRDITY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Asgr2 asialoglycoprotein receptor 2 [ Rattus norvegicus ] |
Official Symbol | Asgr2 |
Synonyms | ASGR2; asialoglycoprotein receptor 2; HL-2; RHL-2; ASGPR 2; ASGP-R 2; hepatic lectin R2/3; hepatic lectin 2 RHL2; hepatic lectin 2, RHL2; MGC108546; |
Gene ID | 29403 |
mRNA Refseq | NM_017189 |
Protein Refseq | NP_058885 |
◆ Recombinant Proteins | ||
ASGR2-6239H | Recombinant Human ASGR2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Asgr2-562R | Recombinant Rat Asgr2 Full Length Transmembrane protein, His-tagged | +Inquiry |
ASGR2-26516TH | Recombinant Human ASGR2 | +Inquiry |
RFL-19265HF | Recombinant Full Length Human Asialoglycoprotein Receptor 2(Asgr2) Protein, His-Tagged | +Inquiry |
ASGR2-197H | Recombinant Human ASGR2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASGR2-1492HCL | Recombinant Human ASGR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Asgr2 Products
Required fields are marked with *
My Review for All Asgr2 Products
Required fields are marked with *
0
Inquiry Basket