Recombinant Rat Asgr2 Full Length Transmembrane protein, His-tagged

Cat.No. : Asgr2-562R
Product Overview : Recombinant Rat Asgr2 protein(P08290)(1-301aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Protein Length : 1-301aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 41.1 kDa
AA Sequence : MEKDFQDIQQLDSEENDHQLIGDEEQGSHVQNLRTENPRWGGQPPSRPFPQRLCSKFRLSLLALAFNILLLVVICVVSSQSMQLQKEFWTLKETLSNFSTTTLMEFKALDSHGGSRNDNLTSWETILEKKQKDIKADHSTLLFHLKHFPLDLRTLTCQLAFFLSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQMENAHLLVINSREEQEFVVKHRGAFHIWIGLTDKDGSWKWVDGTEYRSNFKNWAFTQPDNWQGHEEGGSEDCAEILSDGLWNDNFCQQVNRWACERKRDITY
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Asgr2 asialoglycoprotein receptor 2 [ Rattus norvegicus ]
Official Symbol Asgr2
Synonyms ASGR2; asialoglycoprotein receptor 2; HL-2; RHL-2; ASGPR 2; ASGP-R 2; hepatic lectin R2/3; hepatic lectin 2 RHL2; hepatic lectin 2, RHL2; MGC108546;
Gene ID 29403
mRNA Refseq NM_017189
Protein Refseq NP_058885

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Asgr2 Products

Required fields are marked with *

My Review for All Asgr2 Products

Required fields are marked with *

0
cart-icon