Recombinant Rat Asgr2 Full Length Transmembrane protein, His-tagged
| Cat.No. : | Asgr2-562R |
| Product Overview : | Recombinant Rat Asgr2 protein(P08290)(1-301aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-301aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.1 kDa |
| AA Sequence : | MEKDFQDIQQLDSEENDHQLIGDEEQGSHVQNLRTENPRWGGQPPSRPFPQRLCSKFRLSLLALAFNILLLVVICVVSSQSMQLQKEFWTLKETLSNFSTTTLMEFKALDSHGGSRNDNLTSWETILEKKQKDIKADHSTLLFHLKHFPLDLRTLTCQLAFFLSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQMENAHLLVINSREEQEFVVKHRGAFHIWIGLTDKDGSWKWVDGTEYRSNFKNWAFTQPDNWQGHEEGGSEDCAEILSDGLWNDNFCQQVNRWACERKRDITY |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Asgr2 asialoglycoprotein receptor 2 [ Rattus norvegicus ] |
| Official Symbol | Asgr2 |
| Synonyms | ASGR2; asialoglycoprotein receptor 2; HL-2; RHL-2; ASGPR 2; ASGP-R 2; hepatic lectin R2/3; hepatic lectin 2 RHL2; hepatic lectin 2, RHL2; MGC108546; |
| Gene ID | 29403 |
| mRNA Refseq | NM_017189 |
| Protein Refseq | NP_058885 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Asgr2 Products
Required fields are marked with *
My Review for All Asgr2 Products
Required fields are marked with *



