Recombinant Rat AVPR1A Protein (7-52 aa), GST-tagged

• Cat.No.: AVPR1A-1285R
• Product Overview: Recombinant Rat AVPR1A Protein (7-52 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.

Specification

• Description: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst. Involved in social mory formation.
• Source: E. coli
• Species: Rat
• Tag: GST
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.9 kDa
• Protein length: 7-52 aa
• AA Sequence: SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Avpr1a arginine vasopressin receptor 1A [ Rattus norvegicus ]
• Official Symbol: AVPR1A
• Synonyms: AVPR1A; V1a; AVPR; V1aR; MGC108538
• Gene ID: 25107
• mRNA Refseq: NM_053019
• Protein Refseq: NP_444178
• UniProt ID: P30560