Recombinant Rat AVPR1A Protein (7-52 aa), GST-tagged
Cat.No. : | AVPR1A-1285R |
Product Overview : | Recombinant Rat AVPR1A Protein (7-52 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | GST |
Protein Length : | 7-52 aa |
Description : | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst. Involved in social mory formation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 31.9 kDa |
AA Sequence : | SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | Avpr1a arginine vasopressin receptor 1A [ Rattus norvegicus ] |
Official Symbol | AVPR1A |
Synonyms | AVPR1A; V1a; AVPR; V1aR; MGC108538; |
Gene ID | 25107 |
mRNA Refseq | NM_053019 |
Protein Refseq | NP_444178 |
UniProt ID | P30560 |
◆ Recombinant Proteins | ||
AVPR1A-562R | Recombinant Rat AVPR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
AVPR1A-3772C | Recombinant Chicken AVPR1A | +Inquiry |
AVPR1A-1045H | Recombinant Human AVPR1A protein, GST-tagged | +Inquiry |
AVPR1A-1285R | Recombinant Rat AVPR1A Protein (7-52 aa), GST-tagged | +Inquiry |
AVPR1A-906R | Recombinant Rat AVPR1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AVPR1A-152HCL | Recombinant Human AVPR1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AVPR1A Products
Required fields are marked with *
My Review for All AVPR1A Products
Required fields are marked with *
0
Inquiry Basket