Recombinant Rat AVPR1A Protein (7-52 aa), GST-tagged
Cat.No. : | AVPR1A-1285R |
Product Overview : | Recombinant Rat AVPR1A Protein (7-52 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
Description : | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst. Involved in social mory formation. |
Source : | E. coli |
Species : | Rat |
Tag : | GST |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 31.9 kDa |
Protein length : | 7-52 aa |
AA Sequence : | SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name : | Avpr1a arginine vasopressin receptor 1A [ Rattus norvegicus ] |
Official Symbol : | AVPR1A |
Synonyms : | AVPR1A; V1a; AVPR; V1aR; MGC108538; |
Gene ID : | 25107 |
mRNA Refseq : | NM_053019 |
Protein Refseq : | NP_444178 |
UniProt ID : | P30560 |
Products Types
◆ Recombinant Protein | ||
AVPR1A-562R | Recombinant Rat AVPR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
AVPR1A-3772C | Recombinant Chicken AVPR1A | +Inquiry |
AVPR1A-906R | Recombinant Rat AVPR1A Protein | +Inquiry |
AVPR1A-1045H | Recombinant Human AVPR1A protein, GST-tagged | +Inquiry |
◆ Lysates | ||
AVPR1A-152HCL | Recombinant Human AVPR1A cell lysate | +Inquiry |
◆ Assay kits | ||
Kit-1121 | Total Oxidant Status Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket