Recombinant Rat Bcl2 Full Length Transmembrane protein, His-tagged
| Cat.No. : | Bcl2-1213R |
| Product Overview : | Recombinant Rat Bcl2 protein(P49950)(1-236aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-236aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.1 kDa |
| AA Sequence : | MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Bcl2 B-cell CLL/lymphoma 2 [ Rattus norvegicus ] |
| Official Symbol | Bcl2 |
| Synonyms | BCL2; B-cell CLL/lymphoma 2; apoptosis regulator Bcl-2; Bcl2-like protein; B-cell leukemia/lymphoma 2; B cell lymphoma 2 associated oncogene; Bcl-2; |
| Gene ID | 24224 |
| mRNA Refseq | NM_016993 |
| Protein Refseq | NP_058689 |
| ◆ Recombinant Proteins | ||
| RFL20057MF | Recombinant Full Length Mouse Apoptosis Regulator Bcl-2(Bcl2) Protein, His-Tagged | +Inquiry |
| BCL2-4221H | Recombinant Human (minus BH1 domain) B-Cell CLL/Lymphoma 2, His-tagged | +Inquiry |
| BCL2-22H | Recombinant Human BCL2 Protein | +Inquiry |
| Bcl2-304R | Recombinant Rat Bcl2 Protein, His-tagged | +Inquiry |
| BCL2-615R | Recombinant Rat BCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bcl2 Products
Required fields are marked with *
My Review for All Bcl2 Products
Required fields are marked with *
