Recombinant Rat BMP9 Protein, His tagged

Cat.No. : BMP9-994R
Product Overview : Recombinant Rat BMP9 Protein with His tag was expressed in HEK293.
Availability October 25, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : His
Protein Length : 320-430 aa
Description : Predicted to enable cytokine activity; growth factor activity; and protein serine/threonine kinase activator activity. Predicted to be involved in several processes, including positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway; regulation of endothelial cell proliferation; and transforming growth factor beta receptor superfamily signaling pathway. Predicted to act upstream of or within osteoblast differentiation; positive regulation of gene expression; and positive regulation of transcription by RNA polymerase II. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in hereditary hemorrhagic telangiectasia. Orthologous to human GDF2 (growth differentiation factor 2).
AASequence : STGAASSHCQKTSLRVNFEDIGWDSWIIAPKEYDAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISILYKDDMGVPTLKYHYEGMSVAECGCRDYKDDDDKHHHHHHHH
Molecular Mass : 14 kDa
Purity : > 80% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 0.5% SKL
Concentration : 3.08 mg/mL by BCA
Gene Name Gdf2 growth differentiation factor 2 [ Rattus norvegicus (Norway rat) ]
Official Symbol Gdf2
Synonyms Gdf2; growth differentiation factor 2; growth/differentiation factor 2
Gene ID 290921
mRNA Refseq NM_001106096
Protein Refseq NP_001099566
UniProt ID M0RB87

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Gdf2 Products

Required fields are marked with *

My Review for All Gdf2 Products

Required fields are marked with *

0
cart-icon
0
compare icon