Recombinant Rat BMP9 Protein, His tagged
| Cat.No. : | BMP9-994R |
| Product Overview : | Recombinant Rat BMP9 Protein with His tag was expressed in HEK293. |
| Availability | January 26, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 320-430 aa |
| Description : | Predicted to enable cytokine activity; growth factor activity; and protein serine/threonine kinase activator activity. Predicted to be involved in several processes, including positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway; regulation of endothelial cell proliferation; and transforming growth factor beta receptor superfamily signaling pathway. Predicted to act upstream of or within osteoblast differentiation; positive regulation of gene expression; and positive regulation of transcription by RNA polymerase II. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in hereditary hemorrhagic telangiectasia. Orthologous to human GDF2 (growth differentiation factor 2). |
| AASequence : | STGAASSHCQKTSLRVNFEDIGWDSWIIAPKEYDAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISILYKDDMGVPTLKYHYEGMSVAECGCRDYKDDDDKHHHHHHHH |
| Molecular Mass : | 14 kDa |
| Purity : | > 80% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 0.5% SKL |
| Concentration : | 3.08 mg/mL by BCA |
| Gene Name | Gdf2 growth differentiation factor 2 [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | Gdf2 |
| Synonyms | Gdf2; growth differentiation factor 2; growth/differentiation factor 2 |
| Gene ID | 290921 |
| mRNA Refseq | NM_001106096 |
| Protein Refseq | NP_001099566 |
| UniProt ID | M0RB87 |
| ◆ Recombinant Proteins | ||
| Gdf2-1852M | Recombinant Mouse Gdf2 protein, His-tagged | +Inquiry |
| Gdf2-276M | Active Recombinant Mouse Gdf2 | +Inquiry |
| GDF2-3535H | Recombinant Human GDF2 Protein (Ser320-Arg429), N-His tagged | +Inquiry |
| GDF2-6982C | Recombinant Chicken GDF2 | +Inquiry |
| GDF2-119H | Active Recombinant Human GDF2 Protein (Ser320-Arg429), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GDF2-5970HCL | Recombinant Human GDF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gdf2 Products
Required fields are marked with *
My Review for All Gdf2 Products
Required fields are marked with *
