Recombinant Rat C1qa protein, His-SUMO-tagged
Cat.No. : | C1qa-2610R |
Product Overview : | Recombinant Rat C1qa protein(P31720)(23-245aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 23-245aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | EDVCRAPNGKDGVAGIPGRPGRPGLKGERGEPGAAGIRTGIRGLKGDMGESGPPGKPGNVGFPGPTGPLGNSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPPTYGNVVVFDKVLTNQENPYQNRTGHFICAVPGFYYFTFQVISKWDLCLSIVSSSRGQPRNSLGFCDTNSKGLFQVLAGGTVLQLQRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | C1qa complement component 1, q subcomponent, A chain [ Rattus norvegicus ] |
Official Symbol | C1qa |
Synonyms | C1QA; complement component 1, q subcomponent, A chain; complement C1q subcomponent subunit A; complement component 1, q subcomponent, alpha polypeptide; MGC105755; |
Gene ID | 298566 |
mRNA Refseq | NM_001008515 |
Protein Refseq | NP_001008515 |
◆ Recombinant Proteins | ||
C1QA-0112H | Recombinant Human C1QA Protein (Ala28-Ala245), His-tagged | +Inquiry |
C1qa-2608M | Recombinant Mouse C1qa protein, His-SUMO-tagged | +Inquiry |
C1QA-1345M | Recombinant Mouse C1QA Protein (23-245 aa), His-tagged | +Inquiry |
C1qa-7933R | Recombinant Rat C1qa protein, His & T7-tagged | +Inquiry |
C1QA-1131M | Recombinant Mouse C1QA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C1QA-26126TH | Native Human C1QA | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QA-8143HCL | Recombinant Human C1QA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1qa Products
Required fields are marked with *
My Review for All C1qa Products
Required fields are marked with *
0
Inquiry Basket