Recombinant Rat CA1 Protein (2-261 aa), His-tagged
Cat.No. : | CA1-1347R |
Product Overview : | Recombinant Rat CA1 Protein (2-261 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-261 aa |
Description : | Reversible hydration of carbon dioxide. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 30.2 kDa |
AA Sequence : | ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | Car1 carbonic anhydrase 1 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | CA1 |
Synonyms | Ca1; CA-I; |
Gene ID | 310218 |
mRNA Refseq | NM_001107660 |
Protein Refseq | NP_001101130 |
UniProt ID | B0BNN3 |
◆ Recombinant Proteins | ||
Car1-764M | Recombinant Mouse Car1 Protein, MYC/DDK-tagged | +Inquiry |
CA1-2614H | Recombinant Human CA1 protein, His-SUMO-tagged | +Inquiry |
CA1-2731HF | Recombinant Full Length Human CA1 Protein, GST-tagged | +Inquiry |
CA1-10612H | Recombinant Human CA1, GST-tagged | +Inquiry |
CA1-0468H | Recombinant Human CA1 Protein (Ala2-Phe261), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA1-7917HCL | Recombinant Human CA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA1 Products
Required fields are marked with *
My Review for All CA1 Products
Required fields are marked with *