Recombinant Rat CA1 Protein (2-261 aa), His-tagged

Cat.No. : CA1-1347R
Product Overview : Recombinant Rat CA1 Protein (2-261 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Yeast
Tag : His
Protein Length : 2-261 aa
Description : Reversible hydration of carbon dioxide.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 30.2 kDa
AA Sequence : ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name Car1 carbonic anhydrase 1 [ Rattus norvegicus (Norway rat) ]
Official Symbol CA1
Synonyms Ca1; CA-I;
Gene ID 310218
mRNA Refseq NM_001107660
Protein Refseq NP_001101130
UniProt ID B0BNN3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CA1 Products

Required fields are marked with *

My Review for All CA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon