Recombinant Rat Ca2 protein(2-260aa), His-tagged
Cat.No. : | Ca2-421R |
Product Overview : | Recombinant Rat Ca2 protein(P27139)(2-260aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-260aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SHHWGYSKSNGPENWHKEFPIANGDRQSPVDIDTGTAQHDPSLQPLLICYDKVASKSIVNNGHSFNVEFDDSQDFAVLKEGPLSGSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHLVHWNTKYGDFGKAVQHPDGLAVLGIFLKIGPASQGLQKITEALHSIKTKGKRAAFANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMSHFRKLNFNSEGEAEELMVDNWRPAQPLKNRKIKASFK |
Gene Name | Ca2 carbonic anhydrase 2 [ Rattus norvegicus ] |
Official Symbol | Ca2 |
Synonyms | CA2; carbonic anhydrase 2; CA-II; carbonic anhydrase II; carbonate dehydratase II; Car2; |
Gene ID | 54231 |
mRNA Refseq | NM_019291 |
Protein Refseq | NP_062164 |
◆ Recombinant Proteins | ||
CA2-9899Z | Recombinant Zebrafish CA2 | +Inquiry |
Car2-886M | Active Recombinant Mouse Car2 Protein, His-tagged | +Inquiry |
Car2-7677R | Recombinant Rat Car2 protein, His-tagged | +Inquiry |
CAR2-2718M | Recombinant Mouse CAR2 Protein | +Inquiry |
Car2-1191M | Recombinant Mouse Carbonic Anhydrase 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA2-7915HCL | Recombinant Human CA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ca2 Products
Required fields are marked with *
My Review for All Ca2 Products
Required fields are marked with *