Recombinant Rat Ca2 protein, His-tagged
| Cat.No. : | Ca2-543R |
| Product Overview : | Recombinant Rat Ca2 protein(P27139)(2-260aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 2-260aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | SHHWGYSKSNGPENWHKEFPIANGDRQSPVDIDTGTAQHDPSLQPLLICYDKVASKSIVNNGHSFNVEFDDSQDFAVLKEGPLSGSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHLVHWNTKYGDFGKAVQHPDGLAVLGIFLKIGPASQGLQKITEALHSIKTKGKRAAFANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMSHFRKLNFNSEGEAEELMVDNWRPAQPLKNRKIKASFK |
| Gene Name | Ca2 carbonic anhydrase 2 [ Rattus norvegicus ] |
| Official Symbol | Ca2 |
| Synonyms | CA2; carbonic anhydrase 2; CA-II; carbonic anhydrase II; carbonate dehydratase II; Car2; |
| Gene ID | 54231 |
| mRNA Refseq | NM_019291 |
| Protein Refseq | NP_062164 |
| ◆ Recombinant Proteins | ||
| CA2-716R | Recombinant Rat CA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Car2-7677R | Recombinant Rat Car2 protein, His-tagged | +Inquiry |
| CA2-0237H | Active Recombinant Human CA2 Protein | +Inquiry |
| CA2-2583H | Active Recombinant Human CA2 protein | +Inquiry |
| CA2-144H | Recombinant Human Carbonic Anhydrase II | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CA2-328HKCL | Human CA2 Knockdown Cell Lysate | +Inquiry |
| CA2-7915HCL | Recombinant Human CA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ca2 Products
Required fields are marked with *
My Review for All Ca2 Products
Required fields are marked with *



