Recombinant Rat CAPRIN2 Protein (894-1028 aa), His-tagged
Cat.No. : | CAPRIN2-2529R |
Product Overview : | Recombinant Rat CAPRIN2 Protein (894-1028 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 894-1028 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.2 kDa |
AA Sequence : | PQQMRVAFSAARTSNLAPGTLDQPIVFDLLLNNLGETFDLQLGRFNCPVNGTYVFIFHMLKLAVNVPLYVNLMKNEEVLVSAYANDGAPDHETASNHAILQLLQGDQIWLRLHRGAIYGSSWKYSTFSGYLLYQD |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Caprin2 caprin family member 2 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | CAPRIN2 |
Synonyms | Caprin2; Adir; Rng140; |
Gene ID | 686779 |
UniProt ID | M0R6B1 |
◆ Recombinant Proteins | ||
CAPRIN2-2080Z | Recombinant Zebrafish CAPRIN2 | +Inquiry |
CAPRIN2-2529R | Recombinant Rat CAPRIN2 Protein (894-1028 aa), His-tagged | +Inquiry |
CAPRIN2-10710H | Recombinant Human CAPRIN2, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAPRIN2 Products
Required fields are marked with *
My Review for All CAPRIN2 Products
Required fields are marked with *