Recombinant Rat Ccl4 protein

Cat.No. : Ccl4-634R
Product Overview : Recombinant Rat Ccl4 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 69
Description : Chemokine (C-C motif) ligand 4 encoded by the CCL4 gene, also known as macrophage inflammatory protein-1β (MIP-1β) is a CC chemokine with specificity for CCR5 receptors and it is a major HIV-suppressive factor produced by CD8+ T cells. In addition, it is a chemoattractant for natural killer cells, monocytes and a variety of other immune cells. Recombinant CCL4 induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Furthermore, recombinant rat CCL4 contains 69 amino acids and it shares 80% and 86% a.a. sequence identity with human and murine CCL4. Both human and murine MIP-1α and MIP-1β are active on human and murine hematopoietic cells.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4, 3 % trehalose.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-1000 ng/ml.
Molecular Mass : Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids.
AA Sequence : APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN
Endotoxin : Less than 1 EU/µg of rRtMIP-1β/CCL4 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Ccl4
Official Symbol Ccl4
Synonyms CCL4; chemokine (C-C motif) ligand 4; C-C motif chemokine 4; MIP-1-beta; small inducible cytokine A4; small-inducible cytokine A4; macrophage inflammatory protein 1-beta; macrophage inflammatory protein-1 beta; Scya4; Mip1-b;
Gene ID 116637
mRNA Refseq NM_053858
Protein Refseq NP_446310
UniProt ID P50230

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl4 Products

Required fields are marked with *

My Review for All Ccl4 Products

Required fields are marked with *

0
cart-icon