| Species : |
Rat |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
69 |
| Description : |
Chemokine (C-C motif) ligand 4 encoded by the CCL4 gene, also known as macrophage inflammatory protein-1β (MIP-1β) is a CC chemokine with specificity for CCR5 receptors and it is a major HIV-suppressive factor produced by CD8+ T cells. In addition, it is a chemoattractant for natural killer cells, monocytes and a variety of other immune cells. Recombinant CCL4 induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Furthermore, recombinant rat CCL4 contains 69 amino acids and it shares 80% and 86% a.a. sequence identity with human and murine CCL4. Both human and murine MIP-1α and MIP-1β are active on human and murine hematopoietic cells. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4, 3 % trehalose. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-1000 ng/ml. |
| Molecular Mass : |
Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids. |
| AA Sequence : |
APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN |
| Endotoxin : |
Less than 1 EU/µg of rRtMIP-1β/CCL4 as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |