Recombinant Rat CCL6 protein

Cat.No. : CCL6-1156R
Product Overview : Recombinant Rat CCL6 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 94
Description : Chemokine (C-C motif) ligand 6 (CCL6), encoded by the gene CCL6, is a small cytokine belonging to the CC chemokine family that has only been identified in rodents. It signals primarily through the CCR1 receptor. CCL6 is chemotactic for B cells, CD4+ T cells, monocytes and NK cells and also exhibits powerful suppressive activity on colony formation by different lineages of hematopoietic progenitors. It contains the four highly conserved cysteine residues present in CC chemokines.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 10.4 kDa, a single non-glycosylated polypeptide chain containing 94 amino acids.
AA Sequence : GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA
Endotoxin : Less than 1 EU/μg of rRtC10/CCL6 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CCL6
Official Symbol CCL6
Synonyms CCL6; chemokine (C-C motif) ligand 6; C-C motif chemokine 6; chemokine ligand 6; small-inducible cytokine A6; Mrp-1; Scay6;
Gene ID 287910
mRNA Refseq NM_001004202
Protein Refseq NP_001004202
UniProt ID Q68FP3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL6 Products

Required fields are marked with *

My Review for All CCL6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon