Recombinant Rat CFD Protein, His/MYC-tagged
Cat.No. : | CFD-1165R |
Product Overview : | Recombinant Rat CFD Protein (26-263aa) was expressed in mammalian cells with N-terminal 10xHis-tag and C-terminal Myc-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | His&Myc |
Protein Length : | 26-263 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 29.8 kDa |
AA Sequence : | ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHL YDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPD VLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRK PGVFTRVATYVPWIENVLSGNVSVNVTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Cfd complement factor D [ Rattus norvegicus (Norway rat) ] |
Official Symbol | CFD |
Synonyms | Df; Adn; EVE; Cfd; complement factor D; C3 convertase activator; D component of complement (adipsin); adipsin; endogenous vascular elastase; properdin factor D |
Gene ID | 54249 |
mRNA Refseq | NM_001077642.1 |
Protein Refseq | NP_001071110.1 |
UniProt ID | P32038 |
◆ Recombinant Proteins | ||
CFD-78H | Recombinant Human CFD, His-tagged | +Inquiry |
CFD-2725Z | Recombinant Zebrafish CFD | +Inquiry |
CFD-9822R | Recombinant Rhesus macaque CFD protein, Fc-tagged | +Inquiry |
CFD-1106H | Active Recombinant Human CFD Protein, His-tagged | +Inquiry |
CFD-2178R | Recombinant Rat CFD Protein (26-263 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
CFD-348H | Active Native Human Factor D | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFD-1870MCL | Recombinant Mouse CFD cell lysate | +Inquiry |
CFD-1864HCL | Recombinant Human CFD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFD Products
Required fields are marked with *
My Review for All CFD Products
Required fields are marked with *
0
Inquiry Basket