Recombinant Rat CFD Protein, His/MYC-tagged
| Cat.No. : | CFD-1165R |
| Product Overview : | Recombinant Rat CFD Protein (26-263aa) was expressed in mammalian cells with N-terminal 10xHis-tag and C-terminal Myc-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | HEK293 |
| Tag : | His&Myc |
| Protein Length : | 26-263 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 29.8 kDa |
| AA Sequence : | ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHL YDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPD VLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRK PGVFTRVATYVPWIENVLSGNVSVNVTA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Cfd complement factor D [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | CFD |
| Synonyms | Df; Adn; EVE; Cfd; complement factor D; C3 convertase activator; D component of complement (adipsin); adipsin; endogenous vascular elastase; properdin factor D |
| Gene ID | 54249 |
| mRNA Refseq | NM_001077642.1 |
| Protein Refseq | NP_001071110.1 |
| UniProt ID | P32038 |
| ◆ Recombinant Proteins | ||
| CFD-187H | Recombinant Human CFD protein, His-tagged | +Inquiry |
| CFD-790H | Recombinant Human CFD Protein | +Inquiry |
| CFD-3030H | Active Recombinant Human CFD protein, His-Avi-tagged, Biotinylated | +Inquiry |
| CFD-78H | Recombinant Human CFD, His-tagged | +Inquiry |
| CFD-1106H | Active Recombinant Human CFD Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CFD-348H | Active Native Human Factor D | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CFD-1864HCL | Recombinant Human CFD cell lysate | +Inquiry |
| CFD-1870MCL | Recombinant Mouse CFD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFD Products
Required fields are marked with *
My Review for All CFD Products
Required fields are marked with *



