Recombinant Rat Cxcl12 protein
| Cat.No. : | Cxcl12-65R |
| Product Overview : | Recombinant Rat Cxcl12 alpha protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 68 |
| Description : | CXCL12 also known as SDF-1 is belonging to the CXC chemokine family. It is encoded by the CXCL12 gene. Rat CXCL12 is expressed as two isoforms that differ only in the C-terminal tail. And both SDF-1 isoforms undergo proteolytic processing of the first two N-terminal amino acids. Contrast to SDF-1β, SDF-1α is shorter by four amino acids at the C-terminal tail. On the cell surface, the receptor for this chemokine is CXCR4 and syndecan4. CXCL12 is strongly chemotactic for T-lymphocytes, monocytes, but not neutrophils. SDF-1 is highly conserved between species, rat CXCL12α shares approximately 96% amino acid sequence identity with human CXCL12α. |
| Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. |
| Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 50-100 ng/ml. |
| Molecular Mass : | Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 68 amino acids. |
| AA Sequence : | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNK |
| Endotoxin : | Less than 1 EU/μg of rRtSDF-1α/CXCL12α as determined by LAL method. |
| Purity : | >97% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | Cxcl12 |
| Official Symbol | Cxcl12 |
| Synonyms | CXCL12; chemokine (C-X-C motif) ligand 12; SDF-1 gamma; Stromal cell-derived factor 1; stromal cell-derived factor-1 gamma; chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1); Sdf1; |
| Gene ID | 24772 |
| mRNA Refseq | NM_001033882 |
| Protein Refseq | NP_001029054 |
| UniProt ID | Q9QZD1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl12 Products
Required fields are marked with *
My Review for All Cxcl12 Products
Required fields are marked with *
