Recombinant Rat Efna1 protein, His-tagged
| Cat.No. : | Efna1-2837R |
| Product Overview : | Recombinant Rat Efna1 protein(P97553)(18-182aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 18-182aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 23.4 kDa |
| AA Sequence : | ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGHS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Efna1 ephrin A1 [ Rattus norvegicus ] |
| Official Symbol | Efna1 |
| Synonyms | EFNA1; ephrin A1; ephrin-A1; LERK-1; immediate early response protein B61; EPH-related receptor tyrosine kinase ligand 1; B61; |
| Gene ID | 94268 |
| mRNA Refseq | NM_053599 |
| Protein Refseq | NP_446051 |
| ◆ Recombinant Proteins | ||
| EFNA1-2836H | Recombinant Human EFNA1 protein, His-SUMO-tagged | +Inquiry |
| EFNA1-2238H | Recombinant Human EFNA1 protein(Met1-Ser182), His-tagged | +Inquiry |
| Efna1-1730M | Recombinant Mouse Ephrin A1, Fc-His | +Inquiry |
| EFNA1-1386H | Recombinant Human EFNA1 Protein, MYC/DDK-tagged | +Inquiry |
| EFNA1-2326H | Recombinant Human EFNA1, Fc-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EFNA1-1514RCL | Recombinant Rat EFNA1 cell lysate | +Inquiry |
| EFNA1-2594HCL | Recombinant Human EFNA1 cell lysate | +Inquiry |
| EFNA1-150HKCL | Human EFNA1 Knockdown Cell Lysate | +Inquiry |
| EFNA1-2177MCL | Recombinant Mouse EFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Efna1 Products
Required fields are marked with *
My Review for All Efna1 Products
Required fields are marked with *
