Recombinant Rat Efna1 protein, His-tagged

• Cat.No.: Efna1-2837R
• Product Overview: Recombinant Rat Efna1 protein(P97553)(18-182aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 18-182aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.4 kDa
• AA Sequence: ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGHS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Efna1 ephrin A1 [ Rattus norvegicus ]
• Official Symbol: Efna1
• Synonyms: EFNA1; ephrin A1; ephrin-A1; LERK-1; immediate early response protein B61; EPH-related receptor tyrosine kinase ligand 1; B61
• Gene ID: 94268
• mRNA Refseq: NM_053599
• Protein Refseq: NP_446051