Recombinant Rat Gdnf protein

Cat.No. : Gdnf-595R
Product Overview : Recombinant Rat Gdnf protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 134
Description : Glial cell-derived neurotrophic factor is a founding member of the GDNF family of ligands (GFL) and has been shown to interact with GFRA2 and GDNF family receptor alpha 1. It is a small protein that potently promotes the survival and morphological differentiation of various neuronal. It may also modulate local neuronal effects in distal regions of the motor neuron. GDNF Recombinant rat GDNF (monomer) contains 135 amino acids residues, which is a disulfide-linked homodimer and it shares 99 % and 93 % a.a. sequence identity with mouse and human GDNF.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 1 × PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat C6 cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 29.8 kDa, a homodimeric protein consisting of two 134 amino acid non-glycosylated polypeptide chains.
AA Sequence : SPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCEAAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDSLVYHILRKHSAKRCGCI
Endotoxin : Less than 0.1 EU/μg of rRtGDNF as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Gdnf
Official Symbol Gdnf
Synonyms GDNF; glial cell derived neurotrophic factor; glial cell line-derived neurotrophic factor; ATF; astrocyte-derived trophic factor; Glial cell line derived neutrophic factor; glial cell line derived neurotrophic factor;
Gene ID 25453
mRNA Refseq NM_019139
Protein Refseq NP_062012
UniProt ID Q07731

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Gdnf Products

Required fields are marked with *

My Review for All Gdnf Products

Required fields are marked with *

0
cart-icon