Recombinant Rat GDNF Protein

Cat.No. : GDNF-110R
Product Overview : Recombinant Rat GDNF Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Description : Glial cell-derived neurotrophic factor (GDNF) is a neurotrophic factor that signals through a multicomponent receptor system to activate receptor tyrosine kinase RET signaling. GDNF promotes dopamine uptake, prevents motor neuron apoptosis, and supports the survival and differentiation of neurons.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Dimer, 15.1/30.1 kDa (135/270 aa)
AA Sequence : MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCEAAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDSLVYHILRKHSAKRCGCI
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Gdnf glial cell derived neurotrophic factor [ Rattus norvegicus (Norway rat) ]
Official Symbol GDNF
Synonyms GDNF; glial cell derived neurotrophic factor; glial cell line-derived neurotrophic factor; ATF; astrocyte-derived trophic factor; Glial cell line derived neutrophic factor; glial cell line derived neurotrophic factor;
Gene ID 25453
mRNA Refseq NM_019139
Protein Refseq NP_062012
UniProt ID Q07731

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDNF Products

Required fields are marked with *

My Review for All GDNF Products

Required fields are marked with *

0
cart-icon
0
compare icon