Recombinant Rat Glp1r protein, His-tagged
| Cat.No. : | Glp1r-2967R |
| Product Overview : | Recombinant Rat Glp1r protein(P32301)(22-135aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 22-135aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.1 kDa |
| AA Sequence : | GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Glp1r glucagon-like peptide 1 receptor [ Rattus norvegicus ] |
| Official Symbol | Glp1r |
| Synonyms | GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1; Glip; RATGL1RCP; |
| Gene ID | 25051 |
| mRNA Refseq | NM_012728 |
| Protein Refseq | NP_036860 |
| ◆ Recombinant Proteins | ||
| GLP1R-2565R | Recombinant Rat Glp1r protein, His/SUMO-tagged | +Inquiry |
| GLP1R-584H | Recombinant Human GLP1R protein, mFc-tagged | +Inquiry |
| GLP1R-2755H | Recombinant Human GLP1R Protein, His-tagged | +Inquiry |
| GLP1R-2378H | Recombinant Human GLP1R Full Length Transmembrane protein, His-tagged | +Inquiry |
| Glp1r-4648M | Recombinant Mouse Glp1r protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| GLP1R-549C | Recombinant Cynomolgus GLP1R Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Glp1r Products
Required fields are marked with *
My Review for All Glp1r Products
Required fields are marked with *
