Recombinant Mouse Glp1r protein, His-tagged

Cat.No. : Glp1r-4648M
Product Overview : Recombinant Mouse Glp1r protein(O35659)(22-145 aa), fused with N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 22-145 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 15.9 kDa
AASequence : GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name Glp1r glucagon-like peptide 1 receptor [ Mus musculus ]
Official Symbol Glp1r
Synonyms GLP1R; glucagon-like peptide 1 receptor; GLP-1-R; GLP-1 receptor; GLP-1R; GLP1Rc;
Gene ID 14652
mRNA Refseq NM_021332
Protein Refseq NP_067307

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Glp1r Products

Required fields are marked with *

My Review for All Glp1r Products

Required fields are marked with *

0

Inquiry Basket

cartIcon