Recombinant Mouse Glp1r protein, His-tagged
| Cat.No. : | Glp1r-4648M |
| Product Overview : | Recombinant Mouse Glp1r protein(O35659)(22-145 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 22-145 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 15.9 kDa |
| AASequence : | GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | Glp1r glucagon-like peptide 1 receptor [ Mus musculus ] |
| Official Symbol | Glp1r |
| Synonyms | GLP1R; glucagon-like peptide 1 receptor; GLP-1-R; GLP-1 receptor; GLP-1R; GLP1Rc; |
| Gene ID | 14652 |
| mRNA Refseq | NM_021332 |
| Protein Refseq | NP_067307 |
| ◆ Recombinant Proteins | ||
| GLP1R-4649C | Recombinant Cynomolgus monkey GLP1R protein, His-tagged | +Inquiry |
| RFL22237HF | Recombinant Full Length Human Glucagon-Like Peptide 1 Receptor(Glp1R) Protein, His-Tagged | +Inquiry |
| Glp1r-4650R | Recombinant Rat Glp1r protein, His-tagged | +Inquiry |
| GLP1R-01D | Recombinant Dog GLP1R Protein, His-tagged | +Inquiry |
| GLP1R-1485H | Active Recombinant Human GLP1R protein, His-Avi-tagged, Biotinylated | +Inquiry |
| ◆ Native Proteins | ||
| GLP1R-549C | Recombinant Cynomolgus GLP1R Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Glp1r Products
Required fields are marked with *
My Review for All Glp1r Products
Required fields are marked with *
