Recombinant Rat Hgf Protein, GST-tagged
Cat.No. : | Hgf-1237R |
Product Overview : | Recombinant Rat Hgf Protein (477-728aa) was expressed in E. coli with N-terminal GST-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | GST |
Protein Length : | 477-728 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 55.0 kDa |
AA Sequence : | TIVNLDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKD YEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCS IYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQHK MRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILTYKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Hgf hepatocyte growth factor [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Hgf |
Synonyms | HPTA; Hgf; SF; hepatopoeitin-A; hepatopoietin-A; scatter factor; hepatocyte growth factor |
Gene ID | 24446 |
mRNA Refseq | NM_017017.2 |
Protein Refseq | NP_058713.1 |
UniProt ID | P15776 |
◆ Recombinant Proteins | ||
Hgf-1237R | Recombinant Rat Hgf Protein, GST-tagged | +Inquiry |
HGF-790H | Recombinant Human HGF protein, His-tagged | +Inquiry |
HGF-607HFL | Active Recombinant Full Length Human HGF Protein, C-Flag-tagged | +Inquiry |
HGF-791D | Recombinant Dog HGF protein, His & T7-tagged | +Inquiry |
HGF-5037H | Recombinant Human HGF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
HGF-38P | Native Porcine HGF | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
HGF-29231TH | Native Human HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
HGF-1077CCL | Recombinant Cynomolgus HGF cell lysate | +Inquiry |
HGF-1233RCL | Recombinant Rat HGF cell lysate | +Inquiry |
HGF-1210MCL | Recombinant Mouse HGF cell lysate | +Inquiry |
HGF-001HCL | Recombinant Human HGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Hgf Products
Required fields are marked with *
My Review for All Hgf Products
Required fields are marked with *
0
Inquiry Basket