Recombinant Rat Hgf Protein, GST-tagged
| Cat.No. : | Hgf-1237R |
| Product Overview : | Recombinant Rat Hgf Protein (477-728aa) was expressed in E. coli with N-terminal GST-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 477-728 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 55.0 kDa |
| AA Sequence : | TIVNLDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKD YEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCS IYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQHK MRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILTYKL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Hgf hepatocyte growth factor [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | Hgf |
| Synonyms | HPTA; Hgf; SF; hepatopoeitin-A; hepatopoietin-A; scatter factor; hepatocyte growth factor |
| Gene ID | 24446 |
| mRNA Refseq | NM_017017.2 |
| Protein Refseq | NP_058713.1 |
| UniProt ID | P15776 |
| ◆ Recombinant Proteins | ||
| HGF-872HAF555 | Recombinant Human HGF Protein, None-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| Hgf-8664MAF488 | Recombinant Mouse Hgf Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| HGF-251H | Recombinant Human hepatocyte growth factor Protein, Tag Free | +Inquiry |
| HGF-627H | Recombinant Human Hepatocyte Growth Factor | +Inquiry |
| HGF-267H | Active Recombinant Human HGF Protein | +Inquiry |
| ◆ Native Proteins | ||
| HGF-232P | Native Porcine HGF | +Inquiry |
| HGF-38P | Native Porcine HGF | +Inquiry |
| HGF-29231TH | Native Human HGF | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HGF-001HCL | Recombinant Human HGF cell lysate | +Inquiry |
| HGF-1077CCL | Recombinant Cynomolgus HGF cell lysate | +Inquiry |
| HGF-1210MCL | Recombinant Mouse HGF cell lysate | +Inquiry |
| HGF-1233RCL | Recombinant Rat HGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hgf Products
Required fields are marked with *
My Review for All Hgf Products
Required fields are marked with *
