Recombinant Rat Hpse protein, His&Myc-tagged
| Cat.No. : | Hpse-3051R |
| Product Overview : | Recombinant Rat Hpse protein(Q71RP1)(29-102aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 29-102aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 15.8 kDa |
| AA Sequence : | KDVVDLEFYTKRLFQSVSPSFLSITIDASLATDPRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPNKE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Hpse heparanase [ Rattus norvegicus ] |
| Official Symbol | Hpse |
| Synonyms | HPSE; heparanase; endo-glucoronidase; Hep; Hpa; |
| Gene ID | 64537 |
| mRNA Refseq | NM_022605 |
| Protein Refseq | NP_072127 |
| ◆ Recombinant Proteins | ||
| Hpse-705M | Recombinant Mouse Hpse protein, His-tagged | +Inquiry |
| HPSE-4085Z | Recombinant Zebrafish HPSE | +Inquiry |
| Hpse-707R | Recombinant Rat Hpse protein, His & T7-tagged | +Inquiry |
| HPSE-7838M | Active Recombinant Mouse HPSE Protein, His-tagged | +Inquiry |
| HPSE-3443H | Recombinant Human HPSE Protein (Gln34-Arg115), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HPSE-5393HCL | Recombinant Human HPSE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hpse Products
Required fields are marked with *
My Review for All Hpse Products
Required fields are marked with *



