Recombinant Rat Hpse protein, His&Myc-tagged
Cat.No. : | Hpse-3051R |
Product Overview : | Recombinant Rat Hpse protein(Q71RP1)(29-102aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 29-102aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.8 kDa |
AA Sequence : | KDVVDLEFYTKRLFQSVSPSFLSITIDASLATDPRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPNKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Hpse heparanase [ Rattus norvegicus ] |
Official Symbol | Hpse |
Synonyms | HPSE; heparanase; endo-glucoronidase; Hep; Hpa; |
Gene ID | 64537 |
mRNA Refseq | NM_022605 |
Protein Refseq | NP_072127 |
◆ Recombinant Proteins | ||
Hpse-706M | Recombinant Mouse Hpse protein, His-tagged | +Inquiry |
HPSE-2562R | Recombinant Rat HPSE Protein, His (Fc)-Avi-tagged | +Inquiry |
HPSE-4085Z | Recombinant Zebrafish HPSE | +Inquiry |
HPSE-5019H | Recombinant Human HPSE Protein, GST-tagged | +Inquiry |
HPSE-431H | Active Recombinant Human HPSE protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPSE-5393HCL | Recombinant Human HPSE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hpse Products
Required fields are marked with *
My Review for All Hpse Products
Required fields are marked with *