Recombinant Rat HRAS Protein (2-186 aa), His-tagged

Cat.No. : HRAS-1284R
Product Overview : Recombinant Rat HRAS Protein (2-186 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Protein Length : 2-186 aa
Description : Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.9 kDa
AA Sequence : TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name Hras Harvey rat sarcoma virus oncogene [ Rattus norvegicus ]
Official Symbol HRAS
Synonyms HRAS; GTPase HRas; p21ras; H-Ras-1; HRAS1; c-H-ras;
Gene ID 293621
mRNA Refseq NM_001098241
Protein Refseq NP_001091711
UniProt ID P20171

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HRAS Products

Required fields are marked with *

My Review for All HRAS Products

Required fields are marked with *

0
cart-icon