Recombinant Rat HRAS Protein (2-186 aa), His-tagged
| Cat.No. : | HRAS-1284R |
| Product Overview : | Recombinant Rat HRAS Protein (2-186 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-186 aa |
| Description : | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 24.9 kDa |
| AA Sequence : | TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | Hras Harvey rat sarcoma virus oncogene [ Rattus norvegicus ] |
| Official Symbol | HRAS |
| Synonyms | HRAS; GTPase HRas; p21ras; H-Ras-1; HRAS1; c-H-ras; |
| Gene ID | 293621 |
| mRNA Refseq | NM_001098241 |
| Protein Refseq | NP_001091711 |
| UniProt ID | P20171 |
| ◆ Recombinant Proteins | ||
| HRAS-2141R | Recombinant Rhesus monkey HRAS Protein, His-tagged | +Inquiry |
| HRAS-589H | Recombinant Human HRAS, His-tagged | +Inquiry |
| HRAS-29173TH | Recombinant Human HRAS, His-tagged | +Inquiry |
| HRAS-5013H | Recombinant Human HRAS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HRAS-1284R | Recombinant Rat HRAS Protein (2-186 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HRAS-202HKCL | Human HRAS Knockdown Cell Lysate | +Inquiry |
| HRAS-556HCL | Recombinant Human HRAS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HRAS Products
Required fields are marked with *
My Review for All HRAS Products
Required fields are marked with *
