Recombinant Rat HRAS Protein (2-186 aa), His-tagged
Cat.No. : | HRAS-1284R |
Product Overview : | Recombinant Rat HRAS Protein (2-186 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-186 aa |
Description : | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.9 kDa |
AA Sequence : | TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | Hras Harvey rat sarcoma virus oncogene [ Rattus norvegicus ] |
Official Symbol | HRAS |
Synonyms | HRAS; GTPase HRas; p21ras; H-Ras-1; HRAS1; c-H-ras; |
Gene ID | 293621 |
mRNA Refseq | NM_001098241 |
Protein Refseq | NP_001091711 |
UniProt ID | P20171 |
◆ Recombinant Proteins | ||
HRAS-244HFL | Recombinant Full Length Human HRAS Protein, C-Flag-tagged | +Inquiry |
HRAS-2737H | Recombinant Human HRAS Protein (Phe82-Glu176), N-His tagged | +Inquiry |
HRAS-28759TH | Recombinant Human HRAS | +Inquiry |
HRAS-5023H | Recombinant Human HRAS Protein, GST-tagged | +Inquiry |
HRAS-3650HF | Recombinant Full Length Human HRAS Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HRAS-556HCL | Recombinant Human HRAS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HRAS Products
Required fields are marked with *
My Review for All HRAS Products
Required fields are marked with *
0
Inquiry Basket