Recombinant Rat HRAS Protein (2-186 aa), His-tagged

• Cat.No.: HRAS-1284R
• Product Overview: Recombinant Rat HRAS Protein (2-186 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 2-186 aa
• Description: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.9 kDa
• AA Sequence: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Hras Harvey rat sarcoma virus oncogene [ Rattus norvegicus ]
• Official Symbol: HRAS
• Synonyms: HRAS; GTPase HRas; p21ras; H-Ras-1; HRAS1; c-H-ras
• Gene ID: 293621
• mRNA Refseq: NM_001098241
• Protein Refseq: NP_001091711
• UniProt ID: P20171