Recombinant Rat Ifng protein, GST-tagged
Cat.No. : | Ifng-3078R |
Product Overview : | Recombinant Rat Ifng protein(P01581)(23-156aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | GST |
Protein Length : | 23-156aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.5 kDa |
AA Sequence : | QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Ifng interferon gamma [ Rattus norvegicus ] |
Official Symbol | Ifng |
Synonyms | IFNG; interferon gamma; IFN-gamma; IFNG2; |
Gene ID | 25712 |
mRNA Refseq | NM_138880 |
Protein Refseq | NP_620235 |
◆ Recombinant Proteins | ||
IFNG-26H | Active Recombinant Human Interferon, Gamma | +Inquiry |
IFNG-105I | Active Recombinant Human IFNG Protein (144 aa) | +Inquiry |
IFNG-802C | Recombinant Chicken IFNG protein, His-tagged | +Inquiry |
IFNG-7656H | Recombinant Human IFNG protein, GST-tagged | +Inquiry |
IFNG-09H | Recombinant Human Interferon Gamma | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifng Products
Required fields are marked with *
My Review for All Ifng Products
Required fields are marked with *