Recombinant Rat IL1B Protein
| Cat.No. : | IL1B-152R |
| Product Overview : | Recombinant Rat IL1B Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Description : | Interleukin 1 beta (IL-1β) is a pro-inflammatory cytokine that is produced by monocytes, macrophages, and dendritic cells (DCs). IL-1β signals through the IL-1 receptor, type 1 (IL-1R1) to activate the myeloid differentiation primary response 88 (MYD88) signaling pathway, which contains the cytoplasmic Toll/IL-1 receptor (TIR) domain adapter. IL-1β and the independently regulated IL-1α protein have overlapping proinflammatory activities to induce adhesion molecule expression on epithelial cells, control fever induction, initiate rheumatoid arthritis, and promote septic shock. |
| Bio-activity : | No biological activity data is available at this time. |
| Molecular Mass : | Monomer, 17.4 kDa (153 aa) |
| AA Sequence : | MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | Il1b interleukin 1 beta [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | IL1B |
| Synonyms | IL1B; interleukin 1 beta; interleukin-1 beta; IL-1 beta; |
| Gene ID | 24494 |
| mRNA Refseq | NM_031512 |
| Protein Refseq | NP_113700 |
| UniProt ID | Q63264 |
| ◆ Recombinant Proteins | ||
| IL1B-3098S | Recombinant Sheep IL1B protein, His-tagged | +Inquiry |
| Il1b-102M | Active Recombinant Mouse Il1b Protein | +Inquiry |
| IL1B-2121H | Active Recombinant Human IL1B protein, Fc-tagged | +Inquiry |
| IL1B-1603M | Active Recombinant Mouse IL1B protein, His-tagged | +Inquiry |
| Il1b-040E | Active Recombinant Mouse Il1b (118-269aa), Met tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *
