Recombinant Rat IL1RN Protein, His-tagged
Cat.No. : | IL1RN-103R |
Product Overview : | Recombinant Rat IL1RN Protein, fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | His |
Description : | Enables interleukin-1 receptor binding activity. Involved in several processes, including cellular response to norepinephrine stimulus; chronic inflammatory response to antigenic stimulus; and fever generation. Located in extracellular space. Used to study adult respiratory distress syndrome; anti-basement membrane glomerulonephritis; hypertension; silicosis; and transient cerebral ischemia. Biomarker of encephalitis and pneumonia. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); eye disease (multiple); kidney failure (multiple); lung disease (multiple); and vascular disease (multiple). Orthologous to human IL1RN (interleukin 1 receptor antagonist). |
Form : | PBS, pH 7.4. |
Molecular Mass : | 18.2 kDa |
AA Sequence : | HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQHHHHHH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.63 mg/ml |
Gene Name | Il1rn interleukin 1 receptor antagonist [ Rattus norvegicus (Norway rat) ] |
Official Symbol | IL1RN |
Synonyms | IL-1ra |
Gene ID | 60582 |
mRNA Refseq | NM_022194 |
Protein Refseq | NP_071530 |
UniProt ID | P25086 |
◆ Recombinant Proteins | ||
IL1RN-0278C | Recombinant Cynomolgus IL1RN protein, His-tagged | +Inquiry |
IL1RN-249D | Recombinant Dog IL1RN Protein, His-tagged | +Inquiry |
IL1RN-602H | Recombinant Horse IL1RN protein | +Inquiry |
IL1RN-89P | Recombinant Pig IL1RN protein | +Inquiry |
IL1RN-103R | Recombinant Rat IL1RN Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *
0
Inquiry Basket