Recombinant Rat IL1RN Protein, His-tagged

Cat.No. : IL1RN-103R
Product Overview : Recombinant Rat IL1RN Protein, fused to His-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : His
Description : Enables interleukin-1 receptor binding activity. Involved in several processes, including cellular response to norepinephrine stimulus; chronic inflammatory response to antigenic stimulus; and fever generation. Located in extracellular space. Used to study adult respiratory distress syndrome; anti-basement membrane glomerulonephritis; hypertension; silicosis; and transient cerebral ischemia. Biomarker of encephalitis and pneumonia. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); eye disease (multiple); kidney failure (multiple); lung disease (multiple); and vascular disease (multiple). Orthologous to human IL1RN (interleukin 1 receptor antagonist).
Form : PBS, pH 7.4.
Molecular Mass : 18.2 kDa
AA Sequence : HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQHHHHHH
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.63 mg/ml
Gene Name Il1rn interleukin 1 receptor antagonist [ Rattus norvegicus (Norway rat) ]
Official Symbol IL1RN
Synonyms IL-1ra
Gene ID 60582
mRNA Refseq NM_022194
Protein Refseq NP_071530
UniProt ID P25086

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL1RN Products

Required fields are marked with *

My Review for All IL1RN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon