Recombinant Rat IL1RN Protein, His-tagged

• Cat.No.: IL1RN-103R
• Product Overview: Recombinant Rat IL1RN Protein, fused to His-tag, was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Description: Enables interleukin-1 receptor binding activity. Involved in several processes, including cellular response to norepinephrine stimulus; chronic inflammatory response to antigenic stimulus; and fever generation. Located in extracellular space. Used to study adult respiratory distress syndrome; anti-basement membrane glomerulonephritis; hypertension; silicosis; and transient cerebral ischemia. Biomarker of encephalitis and pneumonia. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); eye disease (multiple); kidney failure (multiple); lung disease (multiple); and vascular disease (multiple). Orthologous to human IL1RN (interleukin 1 receptor antagonist).
• Form: PBS, pH 7.4.
• Molecular Mass: 18.2 kDa
• AA Sequence: HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQHHHHHH
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.63 mg/ml

Gene Information

• Gene Name: Il1rn interleukin 1 receptor antagonist [ Rattus norvegicus (Norway rat) ]
• Official Symbol: IL1RN
• Synonyms: IL-1ra
• Gene ID: 60582
• mRNA Refseq: NM_022194
• Protein Refseq: NP_071530
• UniProt ID: P25086