Recombinant Rat Il3 protein

Cat.No. : Il3-576R
Product Overview : Recombinant Rat Il3 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 144
Description : Interleukin-3 (IL-3) is a type of biological signal (cytokine) which is encoded by the IL-3 gene located on chromosome 5 and produced primarily by activated T cells beside human thymic epithelial cells, activated murine mast cells, murine keratinocytes and neurons/astrocytes. It exerts its biological activities through binding to Interleukin-3 receptors included α and β subunits, but sequence analysis revealed a number of features indicative of the presence of only one β-subunit in the rat. Interleukin-3 acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. Furthermore, rat and human IL-3 share low homology and have not cross species activity.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC-9 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 16.3 kDa, a single non-glycosylated polypeptide chain containing 144 amino acids.
AA Sequence : MISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
Endotoxin : Less than 1 EU/µg of rRtIL-3β as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il3
Official Symbol Il3
Synonyms Hematopoietic Growth Factor, MCGF, Multipotential Colony-stimulating Factor, P-cell-stimulating Factor.
Gene ID 24495
mRNA Refseq NM_031513
Protein Refseq NP_113701
UniProt ID P97688

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il3 Products

Required fields are marked with *

My Review for All Il3 Products

Required fields are marked with *

0
cart-icon
0
compare icon