Recombinant Rat Il3 protein
Cat.No. : | Il3-576R |
Product Overview : | Recombinant Rat Il3 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 144 |
Description : | Interleukin-3 (IL-3) is a type of biological signal (cytokine) which is encoded by the IL-3 gene located on chromosome 5 and produced primarily by activated T cells beside human thymic epithelial cells, activated murine mast cells, murine keratinocytes and neurons/astrocytes. It exerts its biological activities through binding to Interleukin-3 receptors included α and β subunits, but sequence analysis revealed a number of features indicative of the presence of only one β-subunit in the rat. Interleukin-3 acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. Furthermore, rat and human IL-3 share low homology and have not cross species activity. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC-9 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 16.3 kDa, a single non-glycosylated polypeptide chain containing 144 amino acids. |
AA Sequence : | MISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC |
Endotoxin : | Less than 1 EU/µg of rRtIL-3β as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il3 |
Official Symbol | Il3 |
Synonyms | Hematopoietic Growth Factor, MCGF, Multipotential Colony-stimulating Factor, P-cell-stimulating Factor. |
Gene ID | 24495 |
mRNA Refseq | NM_031513 |
Protein Refseq | NP_113701 |
UniProt ID | P97688 |
◆ Recombinant Proteins | ||
IL3-1556H | Recombinant human IL3, Active, His-tagged | +Inquiry |
IL3-2601H | Recombinant Human IL3 protein(41-130 aa), N-MBP & C-His-tagged | +Inquiry |
IL3-35H | Active Recombinant Human IL3 Protein, Animal Free | +Inquiry |
IL3-097I | Active Recombinant Human IL3 Protein (133 aa) | +Inquiry |
Il3-108M | Active Recombinant Mouse Il3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il3 Products
Required fields are marked with *
My Review for All Il3 Products
Required fields are marked with *
0
Inquiry Basket