Recombinant Rat Inhbc protein, His-HSA-tagged

• Cat.No.: Inhbc-4547R
• Product Overview: Recombinant Rat Inhbc protein(Q9WUK5)(237-351 aa), fused with C-terminal His and HSA tag, was expressed in Mammalian Cells.

Specification

• Species: Rat
• Source: Mammalian Cells
• Tag: His&HSA
• Protein Length: 237-351 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 80.7 kDa
• AASequence: INCQGLSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLNLLKANTDAGTARRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Inhbc inhibin beta C [ Rattus norvegicus ]
• Official Symbol: Inhbc
• Synonyms: INHBC; inhibin beta C; inhibin beta C chain; activin beta-C chain; activin/inhibin beta C; MGC108687
• Gene ID: 64549
• mRNA Refseq: NM_022614
• Protein Refseq: NP_072136