Recombinant Rat Inhbc protein, His-HSA-tagged

Cat.No. : Inhbc-4547R
Product Overview : Recombinant Rat Inhbc protein(Q9WUK5)(237-351 aa), fused with C-terminal His and HSA tag, was expressed in Mammalian Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Mammalian Cells
Tag : His&HSA
Protein Length : 237-351 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 80.7 kDa
AASequence : INCQGLSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLNLLKANTDAGTARRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name Inhbc inhibin beta C [ Rattus norvegicus ]
Official Symbol Inhbc
Synonyms INHBC; inhibin beta C; inhibin beta C chain; activin beta-C chain; activin/inhibin beta C; MGC108687;
Gene ID 64549
mRNA Refseq NM_022614
Protein Refseq NP_072136

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Inhbc Products

Required fields are marked with *

My Review for All Inhbc Products

Required fields are marked with *

0

Inquiry Basket

cartIcon