Recombinant Rat Inhbc protein, His-HSA-tagged
Cat.No. : | Inhbc-4547R |
Product Overview : | Recombinant Rat Inhbc protein(Q9WUK5)(237-351 aa), fused with C-terminal His and HSA tag, was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Mammalian Cells |
Tag : | His&HSA |
Protein Length : | 237-351 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 80.7 kDa |
AASequence : | INCQGLSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLNLLKANTDAGTARRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGCS |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Inhbc inhibin beta C [ Rattus norvegicus ] |
Official Symbol | Inhbc |
Synonyms | INHBC; inhibin beta C; inhibin beta C chain; activin beta-C chain; activin/inhibin beta C; MGC108687; |
Gene ID | 64549 |
mRNA Refseq | NM_022614 |
Protein Refseq | NP_072136 |
◆ Recombinant Proteins | ||
INHBC-01H | Active Recombinant Human INHBC Protein | +Inquiry |
INHBC-2401H | Recombinant Human INHBC Protein, MYC/DDK-tagged | +Inquiry |
INHBC-2723R | Recombinant Rat INHBC Protein, His (Fc)-Avi-tagged | +Inquiry |
INHBC-15867H | Recombinant Human INHBC, His-tagged | +Inquiry |
INHBC-3374H | Recombinant Human INHBC Protein (Arg236-Ser352), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHBC-346HCL | Recombinant Human INHBC lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Inhbc Products
Required fields are marked with *
My Review for All Inhbc Products
Required fields are marked with *