Recombinant Rat Klk7 protein, His-tagged
Cat.No. : | Klk7-3140R |
Product Overview : | Recombinant Rat Klk7 protein(P36373)(25-261aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-261aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.3 kDa |
AA Sequence : | VIGGYKCEKNSQPWQVALYSFTKYLCGGVLIDPSWVITAAHCSSNNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPDYKPFLMRNHTRKPGDDHSNDLMLLHLSQPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLIWEFPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCTGDSGGPLLCDGVLQGITSWGSVPCAKTNMPAIYTKLIKFTSWIKEVMKENP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Klk7 kallikrein-related peptidase 7 [ Rattus norvegicus ] |
Official Symbol | Klk7 |
Synonyms | KLK7; kallikrein-related peptidase 7; kallikrein-7; kallikrein 7 (chymotryptic, stratum corneum); kallikrein related-peptidase 7 (chymotryptic, stratum corneum); |
Gene ID | 292852 |
mRNA Refseq | NM_001106254 |
Protein Refseq | NP_001099724 |
◆ Recombinant Proteins | ||
KLK7-889H | Recombinant Human KLK7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KLK7-4880M | Recombinant Mouse KLK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLK7-5019H | Recombinant Human KLK7 Protein (Glu23-Arg253), N-GST tagged | +Inquiry |
KLK7-2375H | Recombinant Human KLK7 Protein, His-tagged | +Inquiry |
KLK7-7169H | Recombinant Human Kallikrein-Related Peptidase 7, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK7-1421MCL | Recombinant Mouse KLK7 cell lysate | +Inquiry |
KLK7-2428HCL | Recombinant Human KLK7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Klk7 Products
Required fields are marked with *
My Review for All Klk7 Products
Required fields are marked with *