Recombinant Rat KLKB1 Protein (391-638 aa), His-tagged

Cat.No. : KLKB1-605R
Product Overview : Recombinant Rat KLKB1 Protein (391-638 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Protein Length : 391-638 aa
Description : The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin syst by converting prorenin into renin.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 31.8 kDa
AA Sequence : IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Klkb1 kallikrein B, plasma 1 [ Rattus norvegicus ]
Official Symbol KLKB1
Synonyms KLKB1; Klk3; Kalp1; KALP15; MGC108748;
Gene ID 25048
mRNA Refseq NM_012725
Protein Refseq NP_036857
UniProt ID P14272

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLKB1 Products

Required fields are marked with *

My Review for All KLKB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon