Recombinant Rat KLKB1 Protein (391-638 aa), His-tagged

• Cat.No.: KLKB1-605R
• Product Overview: Recombinant Rat KLKB1 Protein (391-638 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 391-638 aa
• Description: The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin syst by converting prorenin into renin.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 31.8 kDa
• AA Sequence: IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Klkb1 kallikrein B, plasma 1 [ Rattus norvegicus ]
• Official Symbol: KLKB1
• Synonyms: KLKB1; Klk3; Kalp1; KALP15; MGC108748
• Gene ID: 25048
• mRNA Refseq: NM_012725
• Protein Refseq: NP_036857
• UniProt ID: P14272