Recombinant Rat KLKB1 Protein (391-638 aa), His-tagged
| Cat.No. : | KLKB1-605R |
| Product Overview : | Recombinant Rat KLKB1 Protein (391-638 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 391-638 aa |
| Description : | The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin syst by converting prorenin into renin. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 31.8 kDa |
| AA Sequence : | IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | Klkb1 kallikrein B, plasma 1 [ Rattus norvegicus ] |
| Official Symbol | KLKB1 |
| Synonyms | KLKB1; Klk3; Kalp1; KALP15; MGC108748; |
| Gene ID | 25048 |
| mRNA Refseq | NM_012725 |
| Protein Refseq | NP_036857 |
| UniProt ID | P14272 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLKB1 Products
Required fields are marked with *
My Review for All KLKB1 Products
Required fields are marked with *



