Recombinant Rat KLKB1 Protein (391-638 aa), His-tagged
Cat.No. : | KLKB1-605R |
Product Overview : | Recombinant Rat KLKB1 Protein (391-638 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 391-638 aa |
Description : | The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin syst by converting prorenin into renin. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 31.8 kDa |
AA Sequence : | IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Klkb1 kallikrein B, plasma 1 [ Rattus norvegicus ] |
Official Symbol | KLKB1 |
Synonyms | KLKB1; Klk3; Kalp1; KALP15; MGC108748; |
Gene ID | 25048 |
mRNA Refseq | NM_012725 |
Protein Refseq | NP_036857 |
UniProt ID | P14272 |
◆ Recombinant Proteins | ||
KLKB1-5870HF | Recombinant Full Length Human KLKB1 Protein, GST-tagged | +Inquiry |
KLKB1-2202H | Recombinant Human KLKB1 Protein (20-390 aa), His-tagged | +Inquiry |
Klkb1-117M | Recombinant Mouse Klkb1 Protein, His-tagged | +Inquiry |
Klkb1-606M | Active Recombinant Mouse Klkb1 Protein, His-tagged | +Inquiry |
KLKB1-485H | Recombinant Human KLKB1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
KLKB1-211S | Active Native Porcine Kallikrein | +Inquiry |
KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
KLKB1-210H | Active Native Human Kallikrein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLKB1-4899HCL | Recombinant Human KLKB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLKB1 Products
Required fields are marked with *
My Review for All KLKB1 Products
Required fields are marked with *
0
Inquiry Basket