Recombinant Rat LEFTY1 Protein, His-tagged

• Cat.No.: LEFTY1-19R
• Product Overview: Recombinant Rat LEFTY1 Protein, fused to His-tag, was expressed in HEK293T.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Description: Predicted to enable cytokine activity and nodal binding activity. Predicted to be involved in several processes, including negative regulation of nodal receptor complex assembly; regulation of transmembrane receptor protein serine/threonine kinase signaling pathway; and transmembrane receptor protein serine/threonine kinase signaling pathway. Predicted to act upstream of or within several processes, including anterior/posterior axis specification; cell migration involved in gastrulation; and response to retinoic acid. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to several human genes including LEFTY1 (left-right determination factor 1).
• Form: PBS, pH 7.4.
• Molecular Mass: 40.66 kDa
• AA Sequence: LTGEQVLGSLLQQLRLDRPPVLDKADVEGMVIPSHVRAQYVALLQHSHDSRSRGKRFSQNFREVAGRFLVSETSSHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFREDGSNRTALIDSRLVSIHESGWKVFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGLGEPQLELHTLDLKDYGAQGNCDPETPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQPPESLTIRWPFLGPRQCVASEMTSLPLIVSIKEDGRTRPQVVSLPNMRVQRCSCASDGALIPRRLEPDDDDKHHHHHH
• Endotoxin: <1EU/ug by LAL
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.46 mg/ml

Gene Information

• Gene Name: Lefty1 left right determination factor 1 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: LEFTY1
• Synonyms: RGD1561867
• Gene ID: 498299
• mRNA Refseq: NM_001109080.1
• Protein Refseq: NP_001102550.1
• UniProt ID: D4A670