Recombinant Rat LHCGR Protein (27-362 aa), His-SUMO-tagged

• Cat.No.: LHCGR-624R
• Product Overview: Recombinant Rat LHCGR Protein (27-362 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 27-362 aa
• Description: Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 53.2 kDa
• AA Sequence: RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Lhcgr luteinizing hormone/choriogonadotropin receptor [ Rattus norvegicus (Norway rat) ]
• Official Symbol: LHCGR
• Synonyms: Lhr; LSHR; LSH-R; LH/CG-R
• Gene ID: 25477
• mRNA Refseq: NM_012978
• Protein Refseq: NP_037110
• UniProt ID: P16235