Recombinant Rat LHCGR Protein (27-362 aa), His-tagged
Cat.No. : | LHCGR-1443R |
Product Overview : | Recombinant Rat LHCGR Protein (27-362 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 27-362 aa |
Description : | Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 39.2 kDa |
AA Sequence : | RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Lhcgr luteinizing hormone/choriogonadotropin receptor [ Rattus norvegicus (Norway rat) ] |
Official Symbol | LHCGR |
Synonyms | Lhr; LSHR; LSH-R; LH/CG-R; |
Gene ID | 25477 |
mRNA Refseq | NM_012978 |
Protein Refseq | NP_037110 |
UniProt ID | P16235 |
◆ Recombinant Proteins | ||
RFL33560BF | Recombinant Full Length Bovine Lutropin-Choriogonadotropic Hormone Receptor(Lhcgr) Protein, His-Tagged | +Inquiry |
LHCGR-1442H | Recombinant Human LHCGR Protein (27-363 aa), His-tagged | +Inquiry |
LHCGR-1443R | Recombinant Rat LHCGR Protein (27-362 aa), His-tagged | +Inquiry |
LHCGR-5031H | Recombinant Human LHCGR protein, His-tagged | +Inquiry |
LHCGR-023H | Recombinant Human LHCGR protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LHCGR Products
Required fields are marked with *
My Review for All LHCGR Products
Required fields are marked with *