Recombinant Rat LHCGR Protein (27-362 aa), His-tagged
| Cat.No. : | LHCGR-1443R |
| Product Overview : | Recombinant Rat LHCGR Protein (27-362 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 27-362 aa |
| Description : | Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 39.2 kDa |
| AA Sequence : | RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Lhcgr luteinizing hormone/choriogonadotropin receptor [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | LHCGR |
| Synonyms | Lhr; LSHR; LSH-R; LH/CG-R; |
| Gene ID | 25477 |
| mRNA Refseq | NM_012978 |
| Protein Refseq | NP_037110 |
| UniProt ID | P16235 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LHCGR Products
Required fields are marked with *
My Review for All LHCGR Products
Required fields are marked with *
