Recombinant Rat LOX Protein (163-411 aa), His-tagged
Cat.No. : | LOX-628R |
Product Overview : | Recombinant Rat LOX Protein (163-411 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 163-411 aa |
Description : | Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 33.0 kDa |
AA Sequence : | DDPYNPYKYSDDNPYYNYYDTYERPRSGSRHRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYSNNVVRCEIRYTGHHAYASGCTISPY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Lox lysyl oxidase [ Rattus norvegicus ] |
Official Symbol | LOX |
Synonyms | LOX; lysyl oxidase; Rrg1; H-rev142; |
Gene ID | 24914 |
mRNA Refseq | NM_017061 |
Protein Refseq | NP_058757 |
UniProt ID | P16636 |
◆ Recombinant Proteins | ||
LOX-90H | Recombinant Human LOX, GST-tagged | +Inquiry |
LOX-189H | Recombinant Human LOX protein, GST-tagged | +Inquiry |
LOX-213HFL | Active Recombinant Full Length Human LOX Protein, C-Flag-tagged | +Inquiry |
LOX-4450H | Recombinant Human FMOD (Met1-Trp26) and LOX (Ala22-Tyr417) Protein, N-TwinStrep tagged | +Inquiry |
LOX-9184M | Recombinant Mouse LOX Protein | +Inquiry |
◆ Native Proteins | ||
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
LOX-4677HCL | Recombinant Human LOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOX Products
Required fields are marked with *
My Review for All LOX Products
Required fields are marked with *