Recombinant Rat LOX Protein (163-411 aa), His-tagged

Cat.No. : LOX-628R
Product Overview : Recombinant Rat LOX Protein (163-411 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Protein Length : 163-411 aa
Description : Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 33.0 kDa
AA Sequence : DDPYNPYKYSDDNPYYNYYDTYERPRSGSRHRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYSNNVVRCEIRYTGHHAYASGCTISPY
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Lox lysyl oxidase [ Rattus norvegicus ]
Official Symbol LOX
Synonyms LOX; lysyl oxidase; Rrg1; H-rev142;
Gene ID 24914
mRNA Refseq NM_017061
Protein Refseq NP_058757
UniProt ID P16636

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LOX Products

Required fields are marked with *

My Review for All LOX Products

Required fields are marked with *

0
cart-icon