Recombinant Rat LOX Protein (163-411 aa), His-tagged
| Cat.No. : | LOX-628R |
| Product Overview : | Recombinant Rat LOX Protein (163-411 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 163-411 aa |
| Description : | Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 33.0 kDa |
| AA Sequence : | DDPYNPYKYSDDNPYYNYYDTYERPRSGSRHRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYSNNVVRCEIRYTGHHAYASGCTISPY |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | Lox lysyl oxidase [ Rattus norvegicus ] |
| Official Symbol | LOX |
| Synonyms | LOX; lysyl oxidase; Rrg1; H-rev142; |
| Gene ID | 24914 |
| mRNA Refseq | NM_017061 |
| Protein Refseq | NP_058757 |
| UniProt ID | P16636 |
| ◆ Recombinant Proteins | ||
| LOX-4734H | Recombinant Human LOX Protein, GST-tagged | +Inquiry |
| LOX-7911H | Recombinant Human LOX protein, His-GST-tagged | +Inquiry |
| LOX-3432R | Recombinant Rat LOX Protein | +Inquiry |
| LOX-189H | Recombinant Human LOX protein, GST-tagged | +Inquiry |
| LOX-3088R | Recombinant Rat LOX Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| LOX-41 | Active Native Lactate Oxidase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LOX-4677HCL | Recombinant Human LOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOX Products
Required fields are marked with *
My Review for All LOX Products
Required fields are marked with *
