Recombinant Rat Magt1 protein, His/SUMO-tagged Magt1-16R

Recombinant Rat Magt1 protein, His/SUMO-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Rat Magt1 protein, His/SUMO-tagged

Recombinant Rat Magt1 protein, His/SUMO-tagged

Magt1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MAGT1-16R
Product Overview : Recombinant Rat Magt1(30-335 aa) fused with His/SUMO tag at N-terminal was expressed in E. coli.
Description : Magt1 played an important role in many functions.
Source : E. coli
Species : Rat
Tag : His/SUMO
Form : Tris-based buffer,50% glycerol
Protein length : 30-335 aa
AA Sequence : QRKKEKVLVEKVIQLMEWTNQRPVIRMNGDKFRPLVKAPPRNYSVIVMFTALQLHRQCVV CKQADEEFQILANFWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPPKGKPK RADTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSN MEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAET HIVLLFNGGVTLGMVLLCEAAASDMDIGKRRMMCIAGIGLVVLFFSWMLSIFRSKYHGYP YSFLMS
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.
Gene Name : Magt1 magnesium transporter 1 [ Rattus norvegicus ]
Official Symbol : Magt1
Synonyms : MAGT1; magnesium transporter 1; magnesium transporter protein 1; IAP; implantation-associated protein; Iag2;
Gene ID : 116967
mRNA Refseq : NM_053946
Protein Refseq : NP_446398
UniProt ID : O35777
Chromosome Location : Xq22
Function : magnesium ion transmembrane transporter activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy