Recombinant Rat MAP4K1 Protein, C-His tagged

Cat.No. : MAP4K1-05R
Product Overview : Recombinant Rat MAP4K1 Protein with C-His tag was expressed in Insect cells.
Availability August 24, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Insect Cells
Tag : His
Description : Predicted to enable ATP binding activity and MAP kinase kinase kinase kinase activity. Predicted to be involved in several processes, including JNK cascade; cellular response to phorbol 13-acetate 12-myristate; and protein phosphorylation. Used to study transient cerebral ischemia. Orthologous to human MAP4K1 (mitogen-activated protein kinase kinase kinase kinase 1).
Molecular Mass : The protein has a calculated MW of 34.1 kDa.
AA Sequence : GSATMLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAYDLLQRLGGGTYGEVFKARDKVSKDLVALKMVKMEPDDDVSTLQKEILMLKSCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILINDSGEVKLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSSSFHNFVKVTLTKNSKKRPSATKMLSHQLVHHHHHH
Purity : > 70% by SDS-PAGE
Storage : Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.05 mg/mL
Storage Buffer : PBS, pH 7.4
Gene Name Map4k1 mitogen activated protein kinase kinase kinase kinase 1 [ Rattus norvegicus ]
Official Symbol MAP4K1
Synonyms MAP4K1; mitogen activated protein kinase kinase kinase kinase 1; mitogen-activated protein kinase kinase kinase kinase 1;
Gene ID 292763
mRNA Refseq NM_001106243
Protein Refseq NP_001099713

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAP4K1 Products

Required fields are marked with *

My Review for All MAP4K1 Products

Required fields are marked with *

0
cart-icon
0
compare icon