Recombinant Rat MAP4K1 Protein, C-His tagged

• Cat.No.: MAP4K1-05R
• Product Overview: Recombinant Rat MAP4K1 Protein with C-His tag was expressed in Insect cells.

Specification

• Species: Rat
• Source: Insect Cells
• Tag: His
• Description: Predicted to enable ATP binding activity and MAP kinase kinase kinase kinase activity. Predicted to be involved in several processes, including JNK cascade; cellular response to phorbol 13-acetate 12-myristate; and protein phosphorylation. Used to study transient cerebral ischemia. Orthologous to human MAP4K1 (mitogen-activated protein kinase kinase kinase kinase 1).
• Molecular Mass: The protein has a calculated MW of 34.1 kDa.
• AA Sequence: GSATMLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAYDLLQRLGGGTYGEVFKARDKVSKDLVALKMVKMEPDDDVSTLQKEILMLKSCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILINDSGEVKLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSSSFHNFVKVTLTKNSKKRPSATKMLSHQLVHHHHHH
• Purity: > 70% by SDS-PAGE
• Storage: Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.05 mg/mL
• Storage Buffer: PBS, pH 7.4

Gene Information

• Gene Name: Map4k1 mitogen activated protein kinase kinase kinase kinase 1 [ Rattus norvegicus ]
• Official Symbol: MAP4K1
• Synonyms: MAP4K1; mitogen activated protein kinase kinase kinase kinase 1; mitogen-activated protein kinase kinase kinase kinase 1
• Gene ID: 292763
• mRNA Refseq: NM_001106243
• Protein Refseq: NP_001099713