Recombinant Rat MCPT1 Protein (21-260 aa), Myc-tagged

Cat.No. : MCPT1-2699R
Product Overview : Recombinant Rat MCPT1 Protein (21-260 aa) is produced by E. coli expression system. This protein is fused with a Myc tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Myc
Protein Length : 21-260 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.6 kDa
AA Sequence : IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCKGRETTVTLGVHDVSKTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVDVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNFQVCVGSPRKIRSAYKGDSGGPLVCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIKGKDLTSLSLHESESPS
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Mcpt1 mast cell protease 1 [ Rattus norvegicus ]
Official Symbol MCPT1
Synonyms MCPT1; mast cell protease 1; RMCP-1; RMCP-I; chymase; CLIP protein; mast cell protease I; chymotrysin-like protease;
Gene ID 29265
mRNA Refseq NM_017145
Protein Refseq NP_058841
UniProt ID P09650

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MCPT1 Products

Required fields are marked with *

My Review for All MCPT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon