Recombinant Rat MCPT1 Protein (21-260 aa), Myc-tagged
Cat.No. : | MCPT1-2699R |
Product Overview : | Recombinant Rat MCPT1 Protein (21-260 aa) is produced by E. coli expression system. This protein is fused with a Myc tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Myc |
Protein Length : | 21-260 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.6 kDa |
AA Sequence : | IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCKGRETTVTLGVHDVSKTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVDVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNFQVCVGSPRKIRSAYKGDSGGPLVCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIKGKDLTSLSLHESESPS |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Mcpt1 mast cell protease 1 [ Rattus norvegicus ] |
Official Symbol | MCPT1 |
Synonyms | MCPT1; mast cell protease 1; RMCP-1; RMCP-I; chymase; CLIP protein; mast cell protease I; chymotrysin-like protease; |
Gene ID | 29265 |
mRNA Refseq | NM_017145 |
Protein Refseq | NP_058841 |
UniProt ID | P09650 |
◆ Recombinant Proteins | ||
Mcpt1-306M | Recombinant Mouse MCPT1 protein(Met1-Lys246), His-tagged | +Inquiry |
MCPT1-2699R | Recombinant Rat MCPT1 Protein (21-260 aa), Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCPT1-2749MCL | Recombinant Mouse MCPT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCPT1 Products
Required fields are marked with *
My Review for All MCPT1 Products
Required fields are marked with *
0
Inquiry Basket