Recombinant Rat MCPT1 Protein (21-260 aa), Myc-tagged

• Cat.No.: MCPT1-2699R
• Product Overview: Recombinant Rat MCPT1 Protein (21-260 aa) is produced by E. coli expression system. This protein is fused with a Myc tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: E.coli
• Tag: Myc
• Protein Length: 21-260 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.6 kDa
• AA Sequence: IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCKGRETTVTLGVHDVSKTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVDVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNFQVCVGSPRKIRSAYKGDSGGPLVCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIKGKDLTSLSLHESESPS
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Mcpt1 mast cell protease 1 [ Rattus norvegicus ]
• Official Symbol: MCPT1
• Synonyms: MCPT1; mast cell protease 1; RMCP-1; RMCP-I; chymase; CLIP protein; mast cell protease I; chymotrysin-like protease
• Gene ID: 29265
• mRNA Refseq: NM_017145
• Protein Refseq: NP_058841
• UniProt ID: P09650