Recombinant Rat Mdk protein

Cat.No. : Mdk-92R
Product Overview : Recombinant Rat Mdk protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 120
Description : Heparin-binding growth factor; involved in early fetal development of the rat adrenal.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 13.2 kDa, a single non-glycosylated polypeptide chain containing 120 amino acids.
AA Sequence : VAKKKDKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRIHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKAKAKKGKGKD
Endotoxin : Less than 0.1 EU/μg of rRtMidkine as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Mdk
Official Symbol Mdk
Synonyms MDK; midkine; MK;
Gene ID 81517
mRNA Refseq NM_030859
Protein Refseq NP_110486
UniProt ID Q9R1S9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Mdk Products

Required fields are marked with *

My Review for All Mdk Products

Required fields are marked with *

0
cart-icon