Recombinant Rat Mdk protein
Cat.No. : | Mdk-92R |
Product Overview : | Recombinant Rat Mdk protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 120 |
Description : | Heparin-binding growth factor; involved in early fetal development of the rat adrenal. |
Form : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 13.2 kDa, a single non-glycosylated polypeptide chain containing 120 amino acids. |
AA Sequence : | VAKKKDKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRIHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKAKAKKGKGKD |
Endotoxin : | Less than 0.1 EU/μg of rRtMidkine as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Mdk |
Official Symbol | Mdk |
Synonyms | MDK; midkine; MK; |
Gene ID | 81517 |
mRNA Refseq | NM_030859 |
Protein Refseq | NP_110486 |
UniProt ID | Q9R1S9 |
◆ Recombinant Proteins | ||
Mdk-92R | Recombinant Rat Mdk protein | +Inquiry |
Mdk-67M | Recombinant Mouse Mdk Protein (Gly31-Val119), C-His tagged, Animal-free, Carrier-free | +Inquiry |
MDK-4496H | Recombinant Human MDK Protein, GST-tagged | +Inquiry |
Mdk-0485M | Recombinant Mouse Mdk protein, His-Avi-tagged, Biotinylated | +Inquiry |
MDK-2431H | Recombinant Human MDK Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDK-568HCL | Recombinant Human MDK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mdk Products
Required fields are marked with *
My Review for All Mdk Products
Required fields are marked with *
0
Inquiry Basket