Recombinant Rat Mmp2 protein, His-KSI-tagged

• Cat.No.: Mmp2-2417R
• Product Overview: Recombinant Rat Mmp2 protein(P33436)(412-662aa), fused with N-terminal His and KSI tag, was expressed in E.coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&KSI
• Protein Length: 412-662aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.6 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: EHSQDPGALMAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Gene Information

• Gene Name: Mmp2 matrix metallopeptidase 2 [ Rattus norvegicus ]
• Official Symbol: Mmp2
• Synonyms: MMP2; matrix metallopeptidase 2; 72 kDa type IV collagenase; MMP-2; gelatinase A; 72 kDa gelatinase; matrix metalloproteinase 2; matrix metalloproteinase-2
• Gene ID: 81686
• mRNA Refseq: NM_031054
• Protein Refseq: NP_112316