Recombinant Rat Mmp2 protein, His-KSI-tagged
Cat.No. : | Mmp2-2417R |
Product Overview : | Recombinant Rat Mmp2 protein(P33436)(412-662aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 412-662aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | EHSQDPGALMAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC |
Gene Name | Mmp2 matrix metallopeptidase 2 [ Rattus norvegicus ] |
Official Symbol | Mmp2 |
Synonyms | MMP2; matrix metallopeptidase 2; 72 kDa type IV collagenase; MMP-2; gelatinase A; 72 kDa gelatinase; matrix metalloproteinase 2; matrix metalloproteinase-2; |
Gene ID | 81686 |
mRNA Refseq | NM_031054 |
Protein Refseq | NP_112316 |
◆ Recombinant Proteins | ||
MMP2-1611HFL | Recombinant Full Length Human MMP2 Protein, C-Flag-tagged | +Inquiry |
Mmp2-1783M | Recombinant Mouse Mmp2 Protein, His-tagged | +Inquiry |
MMP2-657R | Recombinant Rat MMP2 Protein (110-662 aa), His-SUMO-tagged | +Inquiry |
MMP2-220H | Active Recombinant Human MMP2 Protein (Tyr120-Cys660), C-His tagged, Animal-free, Carrier-free | +Inquiry |
MMP2-8392HP | Recombinant Human MMP2 protein, GST-tagged, R-PE labeled | +Inquiry |
◆ Native Proteins | ||
MMP2-29475TH | Native Human MMP2 | +Inquiry |
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
MMP2-46H | Native Human MMP-2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP2-2380HCL | Recombinant Human MMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mmp2 Products
Required fields are marked with *
My Review for All Mmp2 Products
Required fields are marked with *