Recombinant Rat MMP7 Protein (98-267 aa), GST-tagged
Cat.No. : | MMP7-659R |
Product Overview : | Recombinant Rat MMP7 Protein (98-267 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | GST |
Protein Length : | 98-267 aa |
Description : | Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 45.9 kDa |
AA Sequence : | FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Mmp7 matrix metallopeptidase 7 [ Rattus norvegicus ] |
Official Symbol | MMP7 |
Synonyms | MMP7; matrilysin; MMP-7; matrin; pump-1 protease; MPMM; |
Gene ID | 25335 |
mRNA Refseq | NM_012864 |
Protein Refseq | NP_036996 |
UniProt ID | P50280 |
◆ Recombinant Proteins | ||
MMP7-49H | Recombinant Human MMP7 protein, His-tagged | +Inquiry |
MMP7-0504H | Active Recombinant Human MMP7 protein, His-tagged | +Inquiry |
MMP7-001H | Recombinant Human MMP7 Protein, His-tagged | +Inquiry |
Mmp7-749R | Recombinant Rat Mmp7 protein, His & T7-tagged | +Inquiry |
Mmp7-203M | Active Recombinant Mouse Mmp7 | +Inquiry |
◆ Native Proteins | ||
MMP7-28205TH | Native Human MMP7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP7-2883HCL | Recombinant Human MMP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP7 Products
Required fields are marked with *
My Review for All MMP7 Products
Required fields are marked with *
0
Inquiry Basket