Recombinant Rat MMP7 Protein (98-267 aa), His-tagged

Cat.No. : MMP7-1458R
Product Overview : Recombinant Rat MMP7 Protein (98-267 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Yeast
Tag : His
Protein Length : 98-267 aa
Description : Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 20.9 kDa
AA Sequence : FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Mmp7 matrix metallopeptidase 7 [ Rattus norvegicus ]
Official Symbol MMP7
Synonyms MMP7; matrilysin; MMP-7; matrin; pump-1 protease; MPMM;
Gene ID 25335
mRNA Refseq NM_012864
Protein Refseq NP_036996
UniProt ID P50280

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MMP7 Products

Required fields are marked with *

My Review for All MMP7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon