Recombinant Rat MMP7 Protein (98-267 aa), His-tagged
| Cat.No. : | MMP7-1458R |
| Product Overview : | Recombinant Rat MMP7 Protein (98-267 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 98-267 aa |
| Description : | Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 20.9 kDa |
| AA Sequence : | FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Mmp7 matrix metallopeptidase 7 [ Rattus norvegicus ] |
| Official Symbol | MMP7 |
| Synonyms | MMP7; matrilysin; MMP-7; matrin; pump-1 protease; MPMM; |
| Gene ID | 25335 |
| mRNA Refseq | NM_012864 |
| Protein Refseq | NP_036996 |
| UniProt ID | P50280 |
| ◆ Recombinant Proteins | ||
| MMP7-47H | Recombinant Human MMP7 protein, His-tagged | +Inquiry |
| MMP7-1126C | Recombinant Cattle MMP7 Protein, His&GST-tagged | +Inquiry |
| MMP7-01H | Active Recombinant Human MMP7 Protein | +Inquiry |
| MMP7-659R | Recombinant Rat MMP7 Protein (98-267 aa), GST-tagged | +Inquiry |
| MMP7-49H | Recombinant Human MMP7 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MMP7-28205TH | Native Human MMP7 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP7-2883HCL | Recombinant Human MMP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP7 Products
Required fields are marked with *
My Review for All MMP7 Products
Required fields are marked with *
