Recombinant Rat Ngf Protein(124-241aa), His-tagged

• Cat.No.: Ngf-489R
• Product Overview: Recombinant Rat Ngf Protein(124-241aa)(P25427), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 124-241aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.2kDa
• AA Sequence: THPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: Ngf nerve growth factor (beta polypeptide) [ Rattus norvegicus ]
• Official Symbol: Ngf
• Synonyms: NGF; nerve growth factor (beta polypeptide); beta-nerve growth factor; beta-NGF; nerve growth factor, beta; Ngfb
• Gene ID: 310738