Recombinant Rat Ngf Protein(124-241aa), His-tagged
Cat.No. : | Ngf-489R |
Product Overview : | Recombinant Rat Ngf Protein(124-241aa)(P25427), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 124-241aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.2kDa |
AA Sequence : | THPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | Ngf nerve growth factor (beta polypeptide) [ Rattus norvegicus ] |
Official Symbol | Ngf |
Synonyms | NGF; nerve growth factor (beta polypeptide); beta-nerve growth factor; beta-NGF; nerve growth factor, beta; Ngfb; |
Gene ID | 310738 |
◆ Recombinant Proteins | ||
NGF-4655H | Recombinant Human NGF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NGF-4703H | Recombinant Human NGF Protein (Ser122-Val238), C-Fc tagged | +Inquiry |
NGF-0302H | Recombinant Human NGF protein | +Inquiry |
Ngf-258M | Recombinant Active Mouse NGF Protein, His-tagged(C-ter) | +Inquiry |
NGF-3158H | Recombinant Human NGF Protein (Ser122-Ala241), His tagged | +Inquiry |
◆ Native Proteins | ||
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGF-001HCL | Recombinant Human NGF cell lysate | +Inquiry |
NGF-001MCL | Recombinant Mouse NGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ngf Products
Required fields are marked with *
My Review for All Ngf Products
Required fields are marked with *