Recombinant Rat Ngf Protein(124-241aa), His-tagged
| Cat.No. : | Ngf-489R |
| Product Overview : | Recombinant Rat Ngf Protein(124-241aa)(P25427), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 124-241aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.2kDa |
| AA Sequence : | THPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | Ngf nerve growth factor (beta polypeptide) [ Rattus norvegicus ] |
| Official Symbol | Ngf |
| Synonyms | NGF; nerve growth factor (beta polypeptide); beta-nerve growth factor; beta-NGF; nerve growth factor, beta; Ngfb; |
| Gene ID | 310738 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ngf Products
Required fields are marked with *
My Review for All Ngf Products
Required fields are marked with *
