Recombinant Rat NOX4 Protein (210-424 aa), His-B2M-tagged
Cat.No. : | NOX4-2200R |
Product Overview : | Recombinant Rat NOX4 Protein (210-424 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 210-424 aa |
Description : | Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 38.6 kDa |
AA Sequence : | GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Nox4 NADPH oxidase 4 [ Rattus norvegicus ] |
Official Symbol | NOX4 |
Synonyms | NOX4; NADPH oxidase 4; kox-1; kidney oxidase-1; kidney superoxide-producing NADPH oxidase; |
Gene ID | 85431 |
mRNA Refseq | NM_053524 |
Protein Refseq | NP_445976 |
UniProt ID | Q924V1 |
◆ Recombinant Proteins | ||
NOX4-2499H | Recombinant Human NOX4 Protein, His-tagged | +Inquiry |
NOX4-3282H | Recombinant Human NOX4 protein, His-tagged | +Inquiry |
Nox4-1840M | Recombinant Mouse Nox4 Protein, His-tagged | +Inquiry |
NOX4-298H | Recombinant Human NOX4 protein, His-tagged(VLPs) | +Inquiry |
NOX4-1328S | Recombinant Sumatran orangutan NOX4 Full Length Transmembrane protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOX4 Products
Required fields are marked with *
My Review for All NOX4 Products
Required fields are marked with *
0
Inquiry Basket